Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293 cells, A549 cells, C6 cells, mouse colon tissue, Caco-2 cells, RAW 264.7 cells, SMMC-7721 cells, HeLa cells, HepG2 cells, Jurkat cells, mouse brain tissue, rat brain tissue, NIH/3T3 cells, mouse liver tissue, rat kidney tissue, rat spleen tissue, rat liver tissue |
| Positive IHC detected in | human colon tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MDCK cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:4000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 4563 publications below |
| IHC | See 4 publications below |
| IF | See 15 publications below |
| IP | See 8 publications below |
| ELISA | See 1 publications below |
| CoIP | See 2 publications below |
Product Information
20536-1-AP targets Beta Actin in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, canine, monkey samples.
| Tested Reactivity | human, mouse, rat, canine, monkey |
| Cited Reactivity | human, mouse, rat, chicken, goat, sheep, yeast, ochotona curzoniae, camelus bactrianus, carp |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14521 Product name: Recombinant human beta actin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC002409 Sequence: MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK 相同性解析による交差性が予測される生物種 |
| Full Name | actin, beta |
| Calculated molecular weight | 375 aa, 42 kDa |
| Observed molecular weight | 42 kDa |
| GenBank accession number | BC002409 |
| Gene Symbol | Beta Actin |
| Gene ID (NCBI) | 60 |
| RRID | AB_10700003 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P60709 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Beta Actin, also named as ACTB and F-Actin, belongs to the actin family. Actins are highly conserved globular proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. At least six isoforms of actins are known in mammals and other vertebrates: alpha (ACTC1, cardiac muscle 1), alpha 1 (ACTA1, skeletal muscle) and 2 (ACTA2, aortic smooth muscle), beta (ACTB), gamma 1 (ACTG1) and 2 (ACTG2, enteric smooth muscle). Beta and gamma 1 are two non-muscle actin proteins. Most actins consist of 376aa, while ACTG2 (rich in muscles) has 375aa and ACTG1(found in non-muscle cells) has only 374aa. Beta actin has been widely used as the internal control in RT-PCR and Western Blotting as a 42-kDa protein. However, the 37-40, 31, 15 kDa cleaved fragment of beta actin can be generated during apoptosis process. This antibody was generated against N-terminal region of human beta actin protein and can cross-react with other actins. (9173887, 11217076, 10229193 )
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Beta Actin antibody 20536-1-AP | Download protocol |
| IHC protocol for Beta Actin antibody 20536-1-AP | Download protocol |
| WB protocol for Beta Actin antibody 20536-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cancer Cell Targeting the immune privilege of tumor-initiating cells to enhance cancer immunotherapy | ||
Nature Aspm knockout ferret reveals an evolutionary mechanism governing cerebral cortical size. | ||
Signal Transduct Target Ther Identifying genetic targets in clinical subtypes of Parkinson's disease for optimizing pharmacological treatment strategies | ||
Cell Microglia jointly degrade fibrillar alpha-synuclein cargo by distribution through tunneling nanotubes. |











