Validation Data Gallery
Tested Applications
Positive WB detected in | mouse brain tissue, rat brain tissue |
Positive IP detected in | mouse brain tissue |
Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse eye tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:12000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 42 publications below |
IHC | See 3 publications below |
IF | See 5 publications below |
IP | See 1 publications below |
CoIP | See 1 publications below |
Product Information
11994-1-AP targets Glutamate receptor 2 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2662 Product name: Recombinant human GRIA2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 36-356 aa of BC010574 Sequence: GADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLSLVEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTTTIKYTSALTYDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGL 相同性解析による交差性が予測される生物種 |
Full Name | glutamate receptor, ionotropic, AMPA 2 |
Calculated molecular weight | 883 aa, 99 kDa |
Observed molecular weight | 94-105 kDa |
GenBank accession number | BC010574 |
Gene Symbol | GRIA2 |
Gene ID (NCBI) | 2891 |
RRID | AB_2113725 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P42262 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. GRIA2 (glutamate receptor 2, GluR-2) belongs to a family of glutamate receptors that are sensitive to alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA), and function as ligand-activated cation channels that mediate the fast component of excitatory postsynaptic currents in neurons of the central nervous system. These channels are assembled from 4 related subunits, GRIA1-4. The presence of GRIA2 in the heteromeric AMPA receptors impermeabilizes it to calcium, preventing possible calcium-mediated toxicity.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Glutamate receptor 2 antibody 11994-1-AP | Download protocol |
IHC protocol for Glutamate receptor 2 antibody 11994-1-AP | Download protocol |
IF protocol for Glutamate receptor 2 antibody 11994-1-AP | Download protocol |
IP protocol for Glutamate receptor 2 antibody 11994-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Biotechnol Magnify is a universal molecular anchoring strategy for expansion microscopy | ||
J Allergy Clin Immunol Six-transmembrane epithelial antigens of the prostate comprise a novel inflammatory nexus in patients with pustular skin disorders. | ||
Sci Adv RNF220 is an E3 ubiquitin ligase for AMPA receptors to regulate synaptic transmission | ||
Mol Psychiatry A recurrent SHANK1 mutation implicated in autism spectrum disorder causes autistic-like core behaviors in mice via downregulation of mGluR1-IP3R1-calcium signaling. | ||
J Clin Invest TMEM25 modulates neuronal excitability and NMDA receptor subunit NR2B degradation. |