Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293 cells, MDCK cells, mouse testis tissue, rat testis tissue | 
| Positive IP detected in | mouse testis tissue | 
| Positive IHC detected in | mouse brain tissue, human endometrial cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 | 
| Positive IF/ICC detected in | hTERT-RPE1 cells, MDCK cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:300-1:800 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 16 publications below | 
| WB | See 47 publications below | 
| IHC | See 6 publications below | 
| IF | See 49 publications below | 
| IP | See 2 publications below | 
| CoIP | See 1 publications below | 
Product Information
13615-1-AP targets IFT20 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, canine samples.
| Tested Reactivity | human, mouse, rat, canine | 
| Cited Reactivity | human, mouse, rat, canine, zebrafish | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | CatNo: Ag4521 Product name: Recombinant human IFT20 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-132 aa of BC038094 Sequence: MAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKMKAIGARNLLKSIAKQREAQQQQLQALIAEKKMQLERYRVEYEALCKVEAEQNEFIDQFIFQK相同性解析による交差性が予測される生物種 | 
| Full Name | intraflagellar transport 20 homolog (Chlamydomonas) | 
| Calculated molecular weight | 15 kDa | 
| Observed molecular weight | 15-18 kDa | 
| GenBank accession number | BC038094 | 
| Gene Symbol | IFT20 | 
| Gene ID (NCBI) | 90410 | 
| RRID | AB_2280001 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q8IY31 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
Intraflagellar transport (IFT), mediated by molecular motors and IFT particles, is an important transport process that occurs in the cilium. IFT particles are multi-subunit complexes that are made up of complex A and complex B. IFT20 is a component of IFT complex B and involved in ciliary process assembly. It is associated with the Golgi complex and plays a role in the trafficking of ciliary membrane proteins from the Golgi complex to the cilium.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for IFT20 antibody 13615-1-AP | Download protocol | 
| IHC protocol for IFT20 antibody 13615-1-AP | Download protocol | 
| IP protocol for IFT20 antibody 13615-1-AP | Download protocol | 
| WB protocol for IFT20 antibody 13615-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
| Nat Cell Biol Early steps in primary cilium assembly require EHD1/EHD3-dependent ciliary vesicle formation. | ||
| Nat Cell Biol Early steps in primary cilium assembly require EHD1/EHD3-dependent ciliary vesicle formation. | ||
| Sci Adv An EMT-primary cilium-GLIS2 signaling axis regulates mammogenesis and claudin-low breast tumorigenesis. | ||
| Nat Commun Microtubule asters anchored by FSD1 control axoneme assembly and ciliogenesis. | ||
| Proc Natl Acad Sci U S A EMT programs promote basal mammary stem cell and tumor-initiating cell stemness by inducing primary ciliogenesis and Hedgehog signaling.
 | 












