Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells, mouse kidney tissue, rat kidney tissue, SH-SY5Y cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse liver tissue, human placenta tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HUVEC cells, HepG2 cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 547 publications below |
| IHC | See 34 publications below |
| IF | See 509 publications below |
| IP | See 5 publications below |
| CoIP | See 1 publications below |
Product Information
11802-1-AP targets TOM20 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, chicken samples.
| Tested Reactivity | human, mouse, rat, chicken |
| Cited Reactivity | human, mouse, rat, pig, rabbit, monkey, chicken, zebrafish, hamster, cattle |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2378 Product name: Recombinant human TOM20 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-145 aa of BC000882 Sequence: MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE 相同性解析による交差性が予測される生物種 |
| Full Name | translocase of outer mitochondrial membrane 20 homolog (yeast) |
| Calculated molecular weight | 145 aa, 16 kDa |
| Observed molecular weight | 16 kDa |
| GenBank accession number | BC000882 |
| Gene Symbol | TOM20 |
| Gene ID (NCBI) | 9804 |
| RRID | AB_2207530 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15388 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Background
TOM20 (KIAA0016) belongs to the Tom family. It is a subunit of the mitochondrial import receptor (PMID: 7584026), whose main role is to translocate cytosolically synthesized mitochondrial proteins through the outer mitochondrial membrane and subsequently facilitate the movement of proteins into the TOM40 translocation pore complex (PMID: 21173275).
What is the molecular weight of TOM20?
It is a short 16.3 kDa protein containing several highly conserved regions, including the transmembrane segment, the ligand-binding domain, and flexible segments at the N terminus and the C terminus of the protein crucial for its function (PMID: 15733919).
What is the subcellular localization of TOM20?
It specifically localizes in the mitochondrial outer membrane. In malignant cells, strong granular staining in the cytoplasm has been observed.
What is the tissue specificity of TOM20?
It is ubiquitously expressed in various tissues, with a particularly high expression in the brain, thyroid, and pancreas.
What is the function of TOM20 in the mitochondrial membrane?
Mitochondrial preproteins are generally synthesized in the cytoplasm with signal or targeting sequences, which are recognized by specific receptors on the outer mitochondrial membrane. TOM20, as one of the components of the TOM40 complex, specifically recognizes pre-sequences on target proteins or their unfolded forms. In addition to its translocase activity, TOM20 may act as a chaperone preventing these proteins from aggregation at the surface of mitochondria (PMID: 14699115).
What is TOM20's involvement in disease?
Diseases linked to the misregulation of TOM20 include Perry Syndrome and neurodegeneration with brain iron accumulation 2A. Numerous studies also associate deregulation of TOM20 with an array of mitochondrial dysfunctions and mitophagy defects (PMIDs: 30254015, 30160596).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for TOM20 antibody 11802-1-AP | Download protocol |
| IF protocol for TOM20 antibody 11802-1-AP | Download protocol |
| IHC protocol for TOM20 antibody 11802-1-AP | Download protocol |
| IP protocol for TOM20 antibody 11802-1-AP | Download protocol |
| WB protocol for TOM20 antibody 11802-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Res AMPK targets PDZD8 to trigger carbon source shift from glucose to glutamine
| ||
Cell Res Mitochondria-localized cGAS suppresses ferroptosis to promote cancer progression | ||















