Validation Data Gallery
Tested Applications
| Positive WB detected in | unboiled HeLa cells, unboiled HepG2 cells |
| Positive IP detected in | human placenta tissue |
| Positive IHC detected in | human liver cancer tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Heating sample to 37°C for 1 hour after lysis is recommended in WB assays
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 109 publications below |
| IHC | See 22 publications below |
| IF | See 15 publications below |
| IP | See 3 publications below |
| CoIP | See 1 publications below |
Product Information
22336-1-AP targets P glycoprotein in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17811 Product name: Recombinant human ABCB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 624-708 aa of BC130424 Sequence: KLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEW 相同性解析による交差性が予測される生物種 |
| Full Name | ATP-binding cassette, sub-family B (MDR/TAP), member 1 |
| Calculated molecular weight | 1280 aa, 142 kDa |
| Observed molecular weight | 130-150 kDa |
| GenBank accession number | BC130424 |
| Gene Symbol | P glycoprotein |
| Gene ID (NCBI) | 5243 |
| RRID | AB_2833023 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P08183 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
ABCB1 (also known as P-gp/ P-glycoprotein, MDR1/multidrug-resistance 1) is a plasma membrane protein first discovered in multidrug resistant tumor cells. ABCB1 can extrude a large number of medically relevant compounds from cells and causes drug resistance. ABCB1 is expressed in a variety of human cancers as well as normal tissues including brain, and placenta. Overexpression of ABCB1 correlates with a negative prognosis in several types of cancer. For optimal WB detection with 22336-1-AP, we recommend to avoid boiling the sample after lysis.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for P glycoprotein antibody 22336-1-AP | Download protocol |
| IP protocol for P glycoprotein antibody 22336-1-AP | Download protocol |
| WB protocol for P glycoprotein antibody 22336-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Drug Resist Updat Lansoprazole (LPZ) reverses multidrug resistance (MDR) in cancer through impeding ATP-binding cassette (ABC) transporter-mediated chemotherapeutic drug efflux and lysosomal sequestration | ||
Drug Resist Updat Cell membrane-camouflaged bufalin targets NOD2 and overcomes multidrug resistance in pancreatic cancer | ||
Mol Cancer Hsa-miR-3178/RhoB/PI3K/Akt, a novel signaling pathway regulates ABC transporters to reverse gemcitabine resistance in pancreatic cancer. | ||
J Control Release cRGD-targeted heparin nanoparticles for effective dual drug treatment of cisplatin-resistant ovarian cancer | ||
ACS Appl Mater Interfaces TPGS-Galactose-Modified Polydopamine Co-delivery Nanoparticles of Nitric Oxide Donor and Doxorubicin for Targeted Chemo-Photothermal Therapy against Drug-Resistant Hepatocellular Carcinoma. |




