Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse heart tissue, mouse brown adipose tissue, mouse kidney tissue, mouse liver tissue, mouse skeletal muscle tissue, rat heart tissue |
| Positive IP detected in | mouse heart tissue |
| Positive IHC detected in | human heart tissue, mouse skeletal muscle tissue, human colon tissue, human liver cancer tissue, stromal tumor tissue, human hysteromyoma tissue, human liver tissue, human small intestine tissue, human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 31 publications below |
| IHC | See 19 publications below |
| IF | See 14 publications below |
Product Information
23081-1-AP targets Alpha smooth muscle actin in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19481 Product name: Recombinant human ACTA2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC017554 Sequence: MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG 相同性解析による交差性が予測される生物種 |
| Full Name | actin, alpha 2, smooth muscle, aorta |
| Calculated molecular weight | 377 aa, 42 kDa |
| Observed molecular weight | 42 kDa |
| GenBank accession number | BC017554 |
| Gene Symbol | Alpha smooth muscle actin |
| Gene ID (NCBI) | 59 |
| RRID | AB_2815024 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P62736 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
ACTA2 (also known as α-smooth muscle actin or α-SMA) belongs to the actin family. Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. ACTA2 is primarily expressed in vascular smooth muscle and anti-ACTA2 is commonly used to marker smooth muscle cells. This antibody is specific to the ACTA2. It selectively stains the vascular smooth muscle but not cardiac or skeletal muscle.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Alpha smooth muscle actin antibody 23081-1-AP | Download protocol |
| IP protocol for Alpha smooth muscle actin antibody 23081-1-AP | Download protocol |
| WB protocol for Alpha smooth muscle actin antibody 23081-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Bioact Mater Magnesium ions attenuate tendon graft fibrosis during its ligamentization after ACL reconstruction through modulation of fibroblast to myofibroblast trans-differentiation by promoting PGE2 secretion | ||
Nat Commun Dental cell type atlas reveals stem and differentiated cell types in mouse and human teeth. | ||
Adv Sci (Weinh) The Composite Antiadhesion Barrier Facilitated Fibroblast Autophagy Activation for Tendon Repair. | ||
Cardiovasc Res Plasma levels of trimethylamine-N-oxide can be increased with 'healthy' and 'unhealthy' diets and do not correlate with the extent of atherosclerosis but with plaque instability. | ||
Pharmacol Res Carnosol-mediated Sirtuin 1 activation inhibits enhancer of Zeste Homolog 2 to attenuate liver fibrosis. |