Validation Data Gallery
Tested Applications
Positive WB detected in | mouse brain tissue, HeLa cells, mouse heart tissue, rat brain tissue, MCF-7 cells |
Positive IP detected in | HeLa cells |
Positive IHC detected in | human placenta tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 8 publications below |
WB | See 26 publications below |
IHC | See 16 publications below |
IF | See 8 publications below |
IP | See 1 publications below |
Product Information
14139-1-AP targets ADAM12 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag5206 Product name: Recombinant human ADAM12 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 31-350 aa of BC060804 Sequence: VSLWNQGRADEVVSASVRSGDLWIPVKSFDSKNHPEVLNIRLQRESKELIINLERNEGLIASSFTETHYLQDGTDVSLARNYTGHCYYHGHVRGYSDSAVSLSTCSGLRGLIVFENESYVLEPMKSATNRYKLFPAKKLKSVRGSCGSHHNTPNLAAKNVFPPPSQTWARRHKRETLKATKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDMDKCSVSQDPFTSLHEFLDWRKMKLLPRKSHDNAQLVSGVYFQGTTIGMAPIMSMCTADQSGGIVMDHSDNPLGAAVTLAHELG 相同性解析による交差性が予測される生物種 |
Full Name | ADAM metallopeptidase domain 12 |
Calculated molecular weight | 100 kDa |
Observed molecular weight | 90-100 kDa, 70-80 kDa |
GenBank accession number | BC060804 |
Gene Symbol | ADAM12 |
Gene ID (NCBI) | 8038 |
RRID | AB_2289230 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O43184 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
ADAM12, also named as MLTN and Meltrin-alpha, is involved in skeletal muscle regeneration, specifically at the onset of cell fusion. It is also involved in macrophage-derived giant cells (MGC) and osteoclast formation from mononuclear precursors. ADAM12 is expressed in human malignant tumors(PMID:17355265). ADAM12's ability to degrade extracellular matrix components likely allows it to detach cancer cells from the basement membrane and assist them on their route to metastasis. But the protein's role not just as a biomarker of breast cancer but as a gateway to cancer cell migration is only now being understood. ADAM12 has 2 isoforms with the calculated molecular mass of 100 and 80 kDa, and this antibody can recognize all isoforms of ADAM12. ADAM12 has 4 forms: 120kDa full-length form, 90kd mature (processed form that lack the prodomain), 50-68kDa degradation product and 27kDa prodomain.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ADAM12 antibody 14139-1-AP | Download protocol |
IHC protocol for ADAM12 antibody 14139-1-AP | Download protocol |
IF protocol for ADAM12 antibody 14139-1-AP | Download protocol |
IP protocol for ADAM12 antibody 14139-1-AP | Download protocol |
FC protocol for ADAM12 antibody 14139-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Stem Cell Vaccination-based immunotherapy to target profibrotic cells in liver and lung | ||
J Cell Biol Notch increases the shedding of HB-EGF by ADAM12 to potentiate invadopodia formation in hypoxia. | ||
Matrix Biol Antibodies and methods for immunohistochemistry of extracellular matrix proteins. | ||
Theranostics Dysregulation of interaction between LOXhigh fibroblast and smooth muscle cells contributes to the pathogenesis of aortic dissection. | ||
Cell Death Differ ADAM12-directed ectodomain shedding of E-cadherin potentiates trophoblast fusion. | ||
J Hematol Oncol Aspartate β-hydroxylase promotes pancreatic ductal adenocarcinoma metastasis through activation of SRC signaling pathway. |