Validation Data Gallery
Tested Applications
| Positive WB detected in | A549 cells, HEK-293 cells, HeLa cells, MCF-7 cells, mouse liver tissue, rat liver, rat liver tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human cervical cancer tissue, human breast hyperplasia tissue, human pancreas cancer tissue, human pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 19 publications below |
| WB | See 301 publications below |
| IHC | See 17 publications below |
| IF | See 19 publications below |
| IP | See 3 publications below |
| CoIP | See 2 publications below |
Product Information
24169-1-AP targets ATF6 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, monkey, chicken, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21456 Product name: Recombinant human ATF6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-194 aa of BC014969 Sequence: MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNLDFDLDLVPWESDIWDINNQICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQT 相同性解析による交差性が予測される生物種 |
| Full Name | activating transcription factor 6 |
| Calculated molecular weight | 75 kDa |
| Observed molecular weight | 60-70 kDa, 90-100 kDa |
| GenBank accession number | BC014969 |
| Gene Symbol | ATF6 |
| Gene ID (NCBI) | 22926 |
| RRID | AB_2876891 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P18850 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Activating transcription factor 6 (ATF6) is a transcription factor that acts during endoplasmic reticulum stress by activating unfolded protein response target genes. ATF6 is the common name for this protein, sometimes also called ATF6A, to distinguish it from the paralogous gene ATF6B. The genes for ATF6A and ATF6B are located on different chromosomes. Binds DNA on the 5'-CCAC[GA]-3'half of the ER stress response element (ERSE) (5'-CCAAT-N(9)-CCAC[GA]-3') and of ERSE II (5'-ATTGG-N-CCACG-3'). Binding to ERSE requires binding of NF-Y to ERSE. Could also be involved in activation of transcription by the serum response factor.During unfolded protein response an approximative 50 kDa fragment containing the cytoplasmic transcription factor domain is released by proteolysis. The cleavage seems to be performed sequentially by site-1 and site-2 proteases. The fully glycosylated form of ATF6, a 670 amino acid protein, exhibits an electrophoretic mobility of ~90 kDa in denaturing SDS-gels, in part because of the glycosylated modifications. ATF6 has 3 consensus sites for N-linked glycosylation and exists constitutively as a glycosylated protein. Differentially glycosylated ATF6 forms may result from mutations or experimental treatment (PMID:15804611) (PMID:14699159). The antibody recognizes cleaved and fully glycosylated forms of ATF6.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ATF6 antibody 24169-1-AP | Download protocol |
| IHC protocol for ATF6 antibody 24169-1-AP | Download protocol |
| IP protocol for ATF6 antibody 24169-1-AP | Download protocol |
| WB protocol for ATF6 antibody 24169-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Stem Cell Amino acid catabolism regulates hematopoietic stem cell proteostasis via a GCN2-eIF2α axis. | ||
J Clin Invest Flavin-containing monooxygenase 2 confers cardioprotection in ischemia models through its disulfide-bond catalytic activity | ||
J Clin Invest Sec13 promotes oligodendrocyte differentiation and myelin repair through autocrine pleiotrophin signaling. | ||
J Clin Invest Inhibition of the unfolded protein response reduces arrhythmia risk after myocardial infarction. | ||
J Clin Invest Ubiquitination of ATF6 by disease-associated RNF186 promotes the innate receptor-induced unfolded protein response. | ||
Circ Res ATF6 Decreases Myocardial Ischemia/Reperfusion Damage and Links ER Stress and Oxidative Stress Signaling Pathways in the Heart. |



















