Validation Data Gallery
Tested Applications
| Positive WB detected in | C2C12 cells, HeLa cells, mouse testis tissue, rat brain tissue, SH-SY5Y cells, Sp2/0 cells, transfected cells, HEK-293 cells, NIH/3T3 cells | 
| Positive IP detected in | SH-SY5Y cells | 
| Positive IHC detected in | human gliomas tissue, human testis tissue,  mouse brain tissue,  rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 | 
| Positive IF/ICC detected in | SH-SY5Y cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 17 publications below | 
| WB | See 34 publications below | 
| IHC | See 2 publications below | 
| IF | See 9 publications below | 
| CoIP | See 2 publications below | 
Product Information
22637-1-AP targets C9orf72 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse, rat, caenorhabditis elegans | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | CatNo: Ag18326 Product name: Recombinant human C9orf72 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-169 aa of BC020851 Sequence: MSTLCPPPSPAVAKTEIALSGKSPLLAATFAYWDNILGPRVRHIWAPKTEQVLLSDGEITFLANHTLNGEILRNAESGAIDVKFFVLSEKGVIIVSLIFDGNWNGDRSTYGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQG相同性解析による交差性が予測される生物種 | 
| Full Name | chromosome 9 open reading frame 72 | 
| Calculated molecular weight | 481 aa, 54 kDa | 
| Observed molecular weight | 50-54 kDa | 
| GenBank accession number | BC020851 | 
| Gene Symbol | C9orf72 | 
| Gene ID (NCBI) | 203228 | 
| RRID | AB_10953528 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q96LT7 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
C9ORF72 has a domain whith polymorphic hexanucleotide repeat (GGGGCC). The C9ORF72-hexanucleotide repeat expansions have been recently identified as genetic markers in amyotrophic lateral sclerosis (ALS) and frontotemporal lobar degeneration (FTLD). The C9ORF72 repeat expansions may indicate a worse prognosis in ALS. Human C9ORF72 has some isoforms with MW 54-60 kDa and 25-30 kDa. Mouse C9orf72 has some isoforms with MW 50-60 kDa and 35 kDa. It has been reported that C9orf72 forms a complex with Cofilin and other actin binding proteins and 22637-1-AP antibody detects the complex bands around 43 and 68-72 kDa in SDS-PAGE.(PMID: 27723745)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for C9orf72 antibody 22637-1-AP | Download protocol | 
| IHC protocol for C9orf72 antibody 22637-1-AP | Download protocol | 
| IP protocol for C9orf72 antibody 22637-1-AP | Download protocol | 
| WB protocol for C9orf72 antibody 22637-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
| Science C9orf72 is required for proper macrophage and microglial function in mice.
 | ||
| Nat Med Haploinsufficiency leads to neurodegeneration in C9ORF72 ALS/FTD human induced motor neurons. | ||
| Cell Metab C9orf72 regulates energy homeostasis by stabilizing mitochondrial complex I assembly.
 | ||
| Nat Neurosci Reduced C9ORF72 function exacerbates gain of toxicity from ALS/FTD-causing repeat expansion in C9orf72.
 | ||
| Nat Commun C9orf72-catalyzed GTP loading of Rab39A enables HOPS-mediated membrane tethering and fusion in mammalian autophagy
 | ||
| Sci Transl Med Loss-of-function mutations in the C9ORF72 mouse ortholog cause fatal autoimmune disease.
 | 


















