Validation Data Gallery
Tested Applications
Positive WB detected in | DU 145 cells, PC-3 cells, BxPC-3 cells, MCF-7 cells |
Positive IHC detected in | human pancreas cancer tissue, human tonsillitis tissue, human breast cancer tissue, human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 11 publications below |
IHC | See 4 publications below |
IF | See 3 publications below |
FC | See 1 publications below |
CoIP | See 1 publications below |
Product Information
23614-1-AP targets MUC1/CA15-3 C-terminal in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag20366 Product name: Recombinant human CA15-3,MUC1 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1055-1255 aa of BC120975 Sequence: NSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL 相同性解析による交差性が予測される生物種 |
Full Name | mucin 1, cell surface associated |
Calculated molecular weight | 1264 aa, 123 kDa |
Observed molecular weight | 23-28 kDa |
GenBank accession number | BC120975 |
Gene Symbol | MUC1/CA15-3 |
Gene ID (NCBI) | 4582 |
RRID | AB_2879304 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P15941 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
MUC1 is a type I transmembrane glycoprotein expressed by various epithelial cells of the female reproductive tract, lung, breast, kidney, stomach, and pancreas. MUC1 is transcribed as a large precursor gene product, and upon translation, is cleaved in the endoplasmic reticulum, yielding two subunits: the large extracellular N-terminal subunit (MUC1-N, about 120-200 kDa) and the small cytoplasmic C-terminal subunit (MUC1-C, about 23-30 kDa). Among the known mucins, MUC1 is best studied and plays crucial roles in regulating many cellular properties, including cell proliferation, apoptosis, adhesion, and invasion. MUC1 is overexpressed in a wide range of human epithelial malignancies. This antibody was raised against the C-terminal region of human MUC1, thus it recognizes the 23-30 kDa cytoplasmic MUC1.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for MUC1/CA15-3 C-terminal antibody 23614-1-AP | Download protocol |
IHC protocol for MUC1/CA15-3 C-terminal antibody 23614-1-AP | Download protocol |
FC protocol for MUC1/CA15-3 C-terminal antibody 23614-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
ACS Sens Rolling Circle Amplification-Assisted Flow Cytometry Approach for Simultaneous Profiling of Exosomal Surface Proteins. | ||
Cell Cycle LINC02535/miR-30a-5p/GALNT3 axis contributes to lung adenocarcinoma progression via the NF- κ B signaling pathway. | ||
Sci Rep Long-term expansion of basal cells and the novel differentiation methods identify mechanisms for switching Claudin expression in normal epithelia | ||
Pathol Res Pract MUC1 promotes cancer stemness and predicts poor prognosis in osteosarcoma
| ||
Cell Death Discov Loss of QKI in macrophage aggravates inflammatory bowel disease through amplified ROS signaling and microbiota disproportion. | ||
Cell Death Discov Silencing of lncRNA MALAT1 facilitates erastin-induced ferroptosis in endometriosis through miR-145-5p/MUC1 signaling. |