Validation Data Gallery
Tested Applications
| Positive WB detected in | Staurosporine treated Jurkat cells, Apoptosised HeLa cells | 
| Positive IP detected in | HeLa cells | 
| Positive IHC detected in | human endometrial cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 | 
| Positive IF/ICC detected in | HepG2 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below | 
Product Information
14311-1-AP targets Caspase 10 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human | 
| Cited Reactivity | human | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | CatNo: Ag5511 Product name: Recombinant human Caspase 10 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 193-522 aa of BC042844 Sequence: AIQIVTPPVDKEAESYQGEEELVSQTDVKTFLEALPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPEQAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRHEDILSILTAVNDDVSRRVDKQGTKKQMPQPAFTLRKKLVFPVPLDALSL相同性解析による交差性が予測される生物種 | 
| Full Name | caspase 10, apoptosis-related cysteine peptidase | 
| Calculated molecular weight | 59 kDa | 
| Observed molecular weight | 59 kDa, 47 kDa, 30-35 kDa | 
| GenBank accession number | BC042844 | 
| Gene Symbol | Caspase 10 | 
| Gene ID (NCBI) | 843 | 
| RRID | AB_2290777 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q92851 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
Caspase 10 (CASP10) is also called MCH4, is a member of the peptidase C14A family, and contains two death
effector (DED) domains.
What is the molecular weight of CASP10?
The molecular weight of CASP10 observed on Western blots may vary depending on which of its isoform,
truncation, or cleavage forms are present. Full-length CASP10 has a propeptide with 219 amino acid and
6 isoforms produced by alternative splicing.
What is the tissue specificity of CASP10?
CASP10 is detectable in most tissues. However, there is lower expression observed in brain, kidney, colon,
prostate, and testis tissue.
What is the function of CASP10?
CASP10 plays a role in the cascade of caspases responsible for executing apoptosis. It is recruited to both
the Fas and TNFR-1 receptors in a FADD dependent manner. CASP10 is responsible for the cleavage and activation of
caspases 3, 4, 6, 7, 8, and 9. CASP10 can be cleaved by granzyme B and autocatalytic activity to generate
two active subunits from its inactive proenzyme form.
What is the role of CASP10 in disease?
Defects in CASP10 lead to autoimmune lymphoproliferative syndrome type 2A (ALPS2A), which is characterized
by abnormal lymphocyte and dendritic cell homeostasis, as well as immune regulatory defects (PMID:16446975).
Defects in CASP10 are also a cause of familial non-Hodgkin lymphoma (NHL) and often marked by enlarged lymph
nodes, weight loss and fever (PMID:12010812), and gastric cancers (GASC) (PMID:11973654).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Caspase 10 antibody 14311-1-AP | Download protocol | 
| IHC protocol for Caspase 10 antibody 14311-1-AP | Download protocol | 
| IP protocol for Caspase 10 antibody 14311-1-AP | Download protocol | 
| WB protocol for Caspase 10 antibody 14311-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
| Front Microbiol Enterovirus 71 Induces INF2 Cleavage via Activated Caspase-2 in Infected RD Cells. | ||
| Front Pharmacol A New Chalcone Derivative C49 Reverses Doxorubicin Resistance in MCF-7/DOX Cells by Inhibiting P-Glycoprotein Expression. | ||
| Apoptosis Strong activation of p53 by actinomycin D and nutlin-3a overcomes the resistance of cancer cells to the pro-apoptotic activity of the FAS ligand | 







