Validation Data Gallery
Tested Applications
| Positive WB detected in | HT-29 cells, C6 cells, HeLa cells, Jurkat cells, NIH/3T3 cells, mouse brain tissue |
| Positive IHC detected in | human pancreas cancer tissue, human pancreas tissue, human skeletal muscle tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 11 publications below |
| WB | See 79 publications below |
| IHC | See 12 publications below |
| IF | See 14 publications below |
| IP | See 1 publications below |
| CoIP | See 2 publications below |
Product Information
10155-1-AP targets CDC42 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, chicken, bovine, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0207 Product name: Recombinant human CDC42 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-186 aa of BC002711 Sequence: MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSR 相同性解析による交差性が予測される生物種 |
| Full Name | cell division cycle 42 (GTP binding protein, 25kDa) |
| Calculated molecular weight | 21 kDa |
| Observed molecular weight | 21 kDa |
| GenBank accession number | BC002711 |
| Gene Symbol | CDC42 |
| Gene ID (NCBI) | 998 |
| RRID | AB_2078096 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P60953 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Cell division control protein 42 (Cdc42), a Rho family small GTPase, is involved in a wide range of basic cellular functions, including actin dynamics, cytoskeletal architecture, the cell cycle and cell polarity. Like all other members of small GTPase superfamily, Cdc42 functions as a molecular switch within the cell by alternating between an inactive GDP-bound form and an active GTP-bound form (PMID: 40296562). Cdc42, the human homologue of the cell division cycle 42 of Saccharomyces cerevisiae, belongs to the Rho/Rac subfamily of Ras-like GTPases. It acts as molecular switches to regulate numerous cellular responses including the organization of the actin cytoskeleton, gene transcription, cell cycle progression, and membrane trafficking. The molecular weight is about 21 kd.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CDC42 antibody 10155-1-AP | Download protocol |
| IHC protocol for CDC42 antibody 10155-1-AP | Download protocol |
| WB protocol for CDC42 antibody 10155-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Spatiotemporal proteomic profiling of the pro-inflammatory response to lipopolysaccharide in the THP-1 human leukaemia cell line. | ||
Circ. Res. Inhibition of KLF5-Myo9b-RhoA Pathway-Mediated Podosome Formation in Macrophages Ameliorates Abdominal Aortic Aneurysm. | ||
Nucleic Acids Res DOCK7 protects against replication stress by promoting RPA stability on chromatin. | ||
Cell Mol Life Sci Crip2 affects vascular development by fine-tuning endothelial cell aggregation and proliferation | ||
Biomaterials Energy metabolism analysis reveals the mechanism of inhibition of breast cancer cell metastasis by PEG-modified graphene oxide nanosheets. | ||
Mol Ther Nucleic Acids miR-497 defect contributes to gastric cancer tumorigenesis and progression via regulating CDC42/ITGB1/FAK/PXN/AKT signaling. |











