Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293T cells, HeLa cells, K-562 cells, MCF-7 cells |
| Positive IP detected in | HEK-293T cells |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293T cells |
| Positive FC (Intra) detected in | HEK-293T cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 46 publications below |
| IHC | See 2 publications below |
| IF | See 5 publications below |
| IP | See 1 publications below |
| CoIP | See 2 publications below |
Product Information
25887-1-AP targets Chk1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22993 Product name: Recombinant human CHK1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 262-476 aa of BC004202 Sequence: DRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDFSPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCPDHMLLNSQLLGTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRRNNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKVWLPAT 相同性解析による交差性が予測される生物種 |
| Full Name | CHK1 checkpoint homolog (S. pombe) |
| Calculated molecular weight | 54 kDa |
| Observed molecular weight | 55 kDa |
| GenBank accession number | BC004202 |
| Gene Symbol | Chk1 |
| Gene ID (NCBI) | 1111 |
| RRID | AB_2880283 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14757 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
CHEK1(Checkpoint kinase-1) is also named as CHK1 and belongs to the protein kinase superfamily. It is implicated in a circuit in which it activates checkpoints, DNA repair and proliferating cell nuclear antigen and FANCD2 monoubiquitinylation(PMID:21389083). CHEK1 protects vertebrate cells against spontaneous chromosome missegregation and is required to sustain anaphase delay when spindle function is disrupted by taxol(PMID:17276342). It has 3 isoforms produced by alternative splicing with the molecular mass of 54 kDa, 44 kDa and 50 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Chk1 antibody 25887-1-AP | Download protocol |
| IF protocol for Chk1 antibody 25887-1-AP | Download protocol |
| IHC protocol for Chk1 antibody 25887-1-AP | Download protocol |
| IP protocol for Chk1 antibody 25887-1-AP | Download protocol |
| WB protocol for Chk1 antibody 25887-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Loss of phosphatase CTDNEP1 potentiates aggressive medulloblastoma by triggering MYC amplification and genomic instability | ||
Cell Death Differ ZNF451 collaborates with RNF8 to regulate RNF168 localization and amplify ubiquitination signaling to promote DNA damage repair and regulate radiosensitivity | ||
Cell Death Differ Deubiquitinase OTUD6A promotes breast cancer progression by increasing TopBP1 stability and rendering tumor cells resistant to DNA-damaging therapy. | ||
Cancer Res Combined inactivation of CTPS1 and ATR is synthetically lethal to MYC-overexpressing cancer cells. | ||
Clin Cancer Res RNF126 as a biomarker of a poor prognosis in invasive breast cancer and CHK1 inhibitor efficacy in breast cancer cells. |





