Validation Data Gallery
Tested Applications
Positive WB detected in | pig skin tissue, human placenta tissue, MG-63 cells, Saos-2 cells, U-87 MG cells |
Positive IP detected in | U-87 MG cells |
Positive IHC detected in | human skin cancer tissue, human colon tissue, human oesophagus cancer tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive FC (Intra) detected in | SW480 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 965 publications below |
IHC | See 260 publications below |
IF | See 226 publications below |
IP | See 1 publications below |
CoIP | See 1 publications below |
Product Information
14695-1-AP targets Collagen Type I in WB, IHC, IF, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, pig samples.
Tested Reactivity | human, pig |
Cited Reactivity | human, mouse, rat, pig, rabbit, canine, chicken, bovine, toad, duck |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag6281 Product name: Recombinant human COL1A2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1017-1366 aa of BC054498 Sequence: RGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPGPPGPPGPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK 相同性解析による交差性が予測される生物種 |
Full Name | collagen, type I, alpha 2 |
Calculated molecular weight | 1366 aa, 130 kDa |
Observed molecular weight | 130-150 kDa |
GenBank accession number | BC054498 |
Gene Symbol | COL1A2 |
Gene ID (NCBI) | 1278 |
RRID | AB_2082037 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P08123 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Type I collagen, the major structural component of connective tissues such as skin, tendon and bone, is the most abundant and widely expressed collagen in humans (PMID: 7620364; 8645190; 9016532). Type I collagen is a heterotrimer comprising one alpha 2(I) and two alpha 1(I) chains which are encoded by the unlinked loci COL1A2 and COL1A1 respectively. Type I collagen has a molecular mass of about 250-300 kDa, while the alpha 2(I) chain has a molecular weight of about 100-140 kDa. Mutations in COL1A2 gene are associated with osteogenesis imperfecta, Ehlers-Danlos syndrome, idiopathic osteoporosis, and atypical Marfan syndrome. This antibody raised against 1017-1366 aa of human pro-alpha 2 chain of type l collagen can recognize collagen alpha 2(1) chain and C-terminal propeptide of pro-alpha 2(1) chain.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Collagen Type I antibody 14695-1-AP | Download protocol |
IHC protocol for Collagen Type I antibody 14695-1-AP | Download protocol |
IP protocol for Collagen Type I antibody 14695-1-AP | Download protocol |
FC protocol for Collagen Type I antibody 14695-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Adv Mater A Superparamagnetic Composite Hydrogel Scaffold as in Vivo Dynamic Monitorable Theranostic Platform for Osteoarthritis Regeneration | ||
Gastroenterology Pancreatic acinar cells-derived sphingosine-1-phosphate contributes to fibrosis of chronic pancreatitis via inducing autophagy and activation of pancreatic stellate cells | ||
Adv Mater Acid-Induced in Situ Phase Separation and Percolation for Constructing Bi-Continuous Phase Hydrogel Electrodes With Motion-Insensitive Property | ||
Gut Histone methyltransferase Suv39h1 regulates hepatic stellate cell activation and is targetable in liver fibrosis | ||
Bioact Mater Synergizing adaptive immunity and regenerative signals to enhance osteochondral defects repair |