Validation Data Gallery
Tested Applications
Positive WB detected in | A431 cells, NIH/3T3 cells, HEK-293 cells, HUVEC cells, HeLa cells, Jurkat cells, MCF-7 cells |
Positive IP detected in | HeLa cells |
Positive IHC detected in | Hepatocellular carcinoma tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HUVEC cells, A549 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:20000-1:100000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:600-1:2400 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 3 publications below |
WB | See 99 publications below |
IHC | See 4 publications below |
IF | See 14 publications below |
CoIP | See 3 publications below |
Product Information
12636-1-AP targets FAK in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, monkey, chicken |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag3331 Product name: Recombinant human FAK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 381-678 aa of BC028733 Sequence: ITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNEGVKLKPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTR 相同性解析による交差性が予測される生物種 |
Full Name | PTK2 protein tyrosine kinase 2 |
Calculated molecular weight | 1052 aa, 119 kDa |
Observed molecular weight | 110 kDa |
GenBank accession number | BC028733 |
Gene Symbol | FAK |
Gene ID (NCBI) | 5747 |
RRID | AB_2173668 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q05397 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
FAK (Focal adhesion kinase 1) is also named as FAK1, FADK, pp125FAK, FAK and belongs to the protein kinase superfamily. It is a critical tyrosine kinase that modulates cell adhesion, migration, proliferation and survival in response to extracellular signals (PMID:19664602). It also acts as a pivotal signal 'integrator', controlling and coordinating cellular responses that include cell migration, survival, proliferation and, epithelial tissue repair after DNA damage (PMID:20966971). This protein has some isoforms produced by alternative promoter usage and alternative splicing, and the range of the molecular weights are 100-120kD and 40-60kD.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for FAK antibody 12636-1-AP | Download protocol |
IHC protocol for FAK antibody 12636-1-AP | Download protocol |
IF protocol for FAK antibody 12636-1-AP | Download protocol |
IP protocol for FAK antibody 12636-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Cell Biol Gain of miR-151 on chromosome 8q24.3 facilitates tumour cell migration and spreading through downregulating RhoGDIA. | ||
J Exp Clin Cancer Res ACTN1 promotes HNSCC tumorigenesis and cisplatin resistance by enhancing MYH9-dependent degradation of GSK-3β and integrin β1-mediated phosphorylation of FAK | ||
Cell Rep Mechanotransduction in response to ECM stiffening impairs cGAS immune signaling in tumor cells | ||
Oncogene KIF26B, a novel oncogene, promotes proliferation and metastasis by activating the VEGF pathway in gastric cancer. |