Validation Data Gallery
Tested Applications
| Positive WB detected in | RAW 264.7 cells | 
| Positive IHC detected in | mouse brain tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 13 publications below | 
| IHC | See 11 publications below | 
| IF | See 10 publications below | 
Product Information
26192-1-AP targets c-Fos in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse, rat, canine | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | CatNo: Ag24340 Product name: Recombinant human FOS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 196-341 aa of BC004490 Sequence: ILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSF相同性解析による交差性が予測される生物種 | 
| Full Name | FOS | 
| Calculated molecular weight | 41 kDa | 
| Observed molecular weight | 65 kDa | 
| GenBank accession number | BC004490 | 
| Gene Symbol | c-Fos | 
| Gene ID (NCBI) | 2353 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | P01100 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
c-Fos, also named as FOS and G0/G1 switch regulatory protein 7, is a 380 amino acid protein, which contains 1 bZIP (basic-leucine zipper) domain and belongs to the bZIP family. c-Fos is expressed at very low levels in quiescent cells. When cells are stimulated to reenter growth, c-Fos undergo 2 waves of expression, the first one peaks 7.5 minutes following FBS induction. At this stage, the c-Fos protein is localized endoplasmic reticulum. The second wave of expression occurs at about 20 minutes after induction and peaks at 1 hour. At this stage, the c-FOS protein becomes nuclear. c-Fos is a very short-lived intracellular protein, which is very easy to degrade. The calculated molecular weight of c-Fos is 40 kDa, but Phosphorylated c-Fos protein is about 60-65 kDa. It is involved in important cellular events, including cell proliferation, differentiation and survival; genes associated with hypoxia; and angiogenesis; which makes its dysregulation an important factor for cancer development. It can also induce a loss of cell polarity and epithelial-mesenchymal transition, leading to invasive and metastatic growth in mammary epithelial cells. Expression of c-Fos is an indirect marker of neuronal activity because c-Fos is often expressed when neurons fire action potentials. Upregulation of c-Fos mRNA in a neuron indicates recent activity.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for c-Fos antibody 26192-1-AP | Download protocol | 
| WB protocol for c-Fos antibody 26192-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
| Neuron Astrocytic ApoE reprograms neuronal cholesterol metabolism and histone-acetylation-mediated memory. | ||
| Nat Commun Ketamine activates adult-born immature granule neurons to rapidly alleviate depression-like behaviors in mice. | ||
| Biol Psychiatry Fighting Females: Neural and Behavioral Consequences of Social Defeat Stress in Female Mice. | ||





