Validation Data Gallery
Tested Applications
Positive WB detected in | HeLa cells, mouse thymus tissue, K-562 cells, NIH/3T3 cells, SH-SY5Y cells, SK-N-SH cells |
Positive IHC detected in | human tonsillitis tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse brain tissue |
Positive IF/ICC detected in | U-87 MG cells |
Positive FC (Intra) detected in | SH-SY5Y cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:8000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 3 publications below |
WB | See 10 publications below |
IHC | See 2 publications below |
IF | See 3 publications below |
Product Information
14384-1-AP targets Fascin in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag5816 Product name: Recombinant human Fascin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-187 aa of BC000521 Sequence: MTANGTAEAVQIQFGLINCGNKYLTAEAFGFKVNASASSLKKKQIWTLEQPPDEAGSAAVCLRSHLGRYLAADKDGNVTCEREVPGPDCRFLIVAHDDGRWSLQSEAHRRYFGGTEDRLSCFAQTVSPAEKWSVHIAMHPQVNIYSVTRKRYAHLSARPADEIAVDRDVPWGVDSLITLAFQDQRYS 相同性解析による交差性が予測される生物種 |
Full Name | fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus) |
Calculated molecular weight | 55 kDa |
Observed molecular weight | 50-55 kDa |
GenBank accession number | BC000521 |
Gene Symbol | Fascin |
Gene ID (NCBI) | 6624 |
ENSEMBL Gene ID | ENSG00000075618 |
RRID | AB_2106381 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q16658 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Fascin is a highly conserved and ubiquitous actin cross-linking protein that has a major function in cell motility and adhesion. Fascin localizes to a number of highly dynamic cellular structures that require strong mechanical support which include stress fibers and cellular protrusions such as microvilli, microspikes and lamellipodia. Fascin is up-regulated in many human carcinomas. It's a marker for Reed-Sternberg cells in Hodgkin's disease; it is also a highly selective marker for dendritic cells of lymphoid tissues.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Fascin antibody 14384-1-AP | Download protocol |
IHC protocol for Fascin antibody 14384-1-AP | Download protocol |
IF protocol for Fascin antibody 14384-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Clin Transl Med Parkin regulates IGF2BP3 through ubiquitination in the tumourigenesis of cervical cancer | ||
Ecotoxicol Environ Saf Prenatal Perfluorooctanoic Acid (PFOA) exposure causes reproductive toxicity by disrupting the formation of transzonal projections (TZPs) and down-regulating Wnt4/β-catenin signaling pathway in progeny | ||
Aging (Albany NY) Exosomal lncRNA LINC01711 facilitates metastasis of esophageal squamous cell carcinoma via the miR-326/FSCN1 axis. | ||
Int J Biol Macromol Recombinant porcine NK-lysin inhibits the invasion of hepatocellular carcinoma cells in vitro. | ||
Exp Cell Res Downregulation of fascin in the first trimester placental villi is associated with early recurrent miscarriage.
| ||
J Exp Clin Cancer Res The role of microRNA-133b and its target gene FSCN1 in gastric cancer. |