Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, mouse thymus tissue, K-562 cells, NIH/3T3 cells, SH-SY5Y cells, SK-N-SH cells |
| Positive IHC detected in | human tonsillitis tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Positive IF/ICC detected in | U-87 MG cells |
| Positive FC (Intra) detected in | SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 11 publications below |
| IHC | See 2 publications below |
| IF | See 3 publications below |
Product Information
14384-1-AP targets Fascin in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5816 Product name: Recombinant human Fascin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-187 aa of BC000521 Sequence: MTANGTAEAVQIQFGLINCGNKYLTAEAFGFKVNASASSLKKKQIWTLEQPPDEAGSAAVCLRSHLGRYLAADKDGNVTCEREVPGPDCRFLIVAHDDGRWSLQSEAHRRYFGGTEDRLSCFAQTVSPAEKWSVHIAMHPQVNIYSVTRKRYAHLSARPADEIAVDRDVPWGVDSLITLAFQDQRYS 相同性解析による交差性が予測される生物種 |
| Full Name | fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus) |
| Calculated molecular weight | 55 kDa |
| Observed molecular weight | 50-55 kDa |
| GenBank accession number | BC000521 |
| Gene Symbol | Fascin |
| Gene ID (NCBI) | 6624 |
| ENSEMBL Gene ID | ENSG00000075618 |
| RRID | AB_2106381 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q16658 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Fascin is a highly conserved and ubiquitous actin cross-linking protein that has a major function in cell motility and adhesion. Fascin localizes to a number of highly dynamic cellular structures that require strong mechanical support which include stress fibers and cellular protrusions such as microvilli, microspikes and lamellipodia. Fascin is up-regulated in many human carcinomas. It's a marker for Reed-Sternberg cells in Hodgkin's disease; it is also a highly selective marker for dendritic cells of lymphoid tissues.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Fascin antibody 14384-1-AP | Download protocol |
| IF protocol for Fascin antibody 14384-1-AP | Download protocol |
| IHC protocol for Fascin antibody 14384-1-AP | Download protocol |
| WB protocol for Fascin antibody 14384-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Clin Transl Med Parkin regulates IGF2BP3 through ubiquitination in the tumourigenesis of cervical cancer | ||
Ecotoxicol Environ Saf Prenatal Perfluorooctanoic Acid (PFOA) exposure causes reproductive toxicity by disrupting the formation of transzonal projections (TZPs) and down-regulating Wnt4/β-catenin signaling pathway in progeny | ||
Aging (Albany NY) Exosomal lncRNA LINC01711 facilitates metastasis of esophageal squamous cell carcinoma via the miR-326/FSCN1 axis. | ||
Int J Biol Macromol Recombinant porcine NK-lysin inhibits the invasion of hepatocellular carcinoma cells in vitro. | ||
Exp Cell Res Downregulation of fascin in the first trimester placental villi is associated with early recurrent miscarriage.
| ||
J Exp Clin Cancer Res The role of microRNA-133b and its target gene FSCN1 in gastric cancer. |











