Validation Data Gallery
Tested Applications
Positive WB detected in | LPS and Protein transport inhibitor treated HUVEC cells |
Positive IP detected in | LPS and Protein transport inhibitor treated HUVEC cells |
Positive IF/ICC detected in | LPS and Brefeldin A treated HUVEC cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 5 publications below |
WB | See 119 publications below |
IHC | See 188 publications below |
IF | See 38 publications below |
ELISA | See 5 publications below |
Product Information
21865-1-AP targets IL-6 in WB, IHC, IP, Neutralization, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, pig, rabbit, canine, bovine, goat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag10565 Product name: Recombinant human IL-6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-212 aa of BC015511 Sequence: MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 相同性解析による交差性が予測される生物種 |
Full Name | interleukin 6 (interferon, beta 2) |
Calculated molecular weight | 212 aa, 24 kDa |
Observed molecular weight | 20 kDa |
GenBank accession number | BC015511 |
Gene Symbol | IL6 |
Gene ID (NCBI) | 3569 |
ENSEMBL Gene ID | ENSG00000136244 |
RRID | AB_11142677 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P05231 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. IL-6 protein is secreted by a variety of cell types including T cells and macrophages as phosphorylated and variably glycosylated molecule. IL-6 plays an essential role in the final differentiation of B-cells into Ig-secreting cells involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. IL-6 is also considered a myokine, a cytokine produced from muscle, and is elevated in response to muscle contraction. IL-6 has been shown to interact with interleukin-6 receptor and glycoprotein 130. Additionally, IL-6 is involved in hematopoiesis, bone metabolism, and cancer progression, and has been defined an essential role in directing transition from innate to acquired immunity.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for IL-6 antibody 21865-1-AP | Download protocol |
IF protocol for IL-6 antibody 21865-1-AP | Download protocol |
IP protocol for IL-6 antibody 21865-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Biotechnol Magnify is a universal molecular anchoring strategy for expansion microscopy | ||
J Hematol Oncol FFAR2 expressing myeloid-derived suppressor cells drive cancer immunoevasion | ||
Cancer Cell Cathepsin C promotes breast cancer lung metastasis by modulating neutrophil infiltration and neutrophil extracellular trap formation. | ||
Bioact Mater A bioactive composite hydrogel dressing that promotes healing of both acute and chronic diabetic skin wounds | ||
Bioact Mater Genetically engineered M2-like macrophage-derived exosomes for P. gingivalis-suppressed cementum regeneration: From mechanism to therapy | ||
ACS Cent Sci Macrophage Inactivation by Small Molecule Wedelolactone via Targeting sEH for the Treatment of LPS-Induced Acute Lung Injury |