Validation Data Gallery
Tested Applications
| Positive WB detected in | TF-1 cells, THP-1 cells |
| Positive IHC detected in | human tonsillitis tissue, Insulinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue |
| Positive IF/ICC detected in | THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 10 publications below |
| IHC | See 15 publications below |
| IF | See 26 publications below |
Product Information
21851-1-AP targets CD11b in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, pig, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16327 Product name: Recombinant human CD11B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 127-320 aa of BC096346 Sequence: GSNLRQQPQKFPEALRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEA 相同性解析による交差性が予測される生物種 |
| Full Name | integrin, alpha M (complement component 3 receptor 3 subunit) |
| Calculated molecular weight | 1152 aa, 127 kDa |
| Observed molecular weight | 170 kDa |
| GenBank accession number | BC096346 |
| Gene Symbol | CD11b |
| Gene ID (NCBI) | 3684 |
| ENSEMBL Gene ID | ENSG00000169896 |
| RRID | AB_2878927 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P11215 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated α and β subunits (PMID: 9779984). CD11b, also known as Integrin alpha M or CR3A, belongs to the integrin alpha chain family. CD11b forms an α/β heterodimer with CD18 (integrin β2). CD11b/CD18 is implicated in various adhesive interactions of monocytes, macrophages and granulocytes as well as in mediating the uptake of complement-coated particles and pathogens (PMID: 9558116; 20008295). CD11b/CD18 is a receptor for the complement protein fragment iC3b, and is also a receptor for fibrinogen, factor X and ICAM1 (PMID: 2971974; 15485828).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD11b antibody 21851-1-AP | Download protocol |
| IHC protocol for CD11b antibody 21851-1-AP | Download protocol |
| WB protocol for CD11b antibody 21851-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
ACS Nano Biomimetic Ginsenoside Rb1 and Probucol Co-Assembled Nanoparticles for Targeted Atherosclerosis Therapy via Inhibition of Oxidative Stress, Inflammation, and Lipid Deposition | ||
Aging Cell Advanced maternal age causes premature placental senescence and malformation via dysregulated α-Klotho expression in trophoblasts. | ||
Biomaterials Light-controlled oxygen production and collection for sustainable photodynamic therapy in tumor hypoxia. | ||
ACS Appl Mater Interfaces Catalysis-Mediated Male Contraception through Black Phosphorus Nanosheets | ||
Int J Biol Macromol Repairing gastric ulcer with hyaluronic acid/extracellular matrix composite through promoting M2-type polarization of macrophages | ||
Biomater Sci A hybrid hydrogel composed of chitin and β-glucan for the effective management of wound healing and scarring |









