Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, NIH/3T3 cells, HepG2 cells, Jurkat cells, MCF-7 cells, K-562 cells, RAW 264.7 cells, mouse heart tissue, rat heart tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse heart tissue, human colon tissue, human colon cancer tissue, human hepatocellular carcinoma, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 8 publications below |
| WB | See 1541 publications below |
| IHC | See 15 publications below |
| IF | See 107 publications below |
| IP | See 5 publications below |
| CoIP | See 2 publications below |
| ChIP | See 5 publications below |
Product Information
12987-1-AP targets Lamin B1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, monkey, chicken, hamster, escherichia coli, bombyx mori |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3631 Product name: Recombinant human Lamin B1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 237-587 aa of BC012295 Sequence: EYEYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMRIESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIRDQMQQQLNDYEQLLDVKLALDMEISAYRKLLQGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM 相同性解析による交差性が予測される生物種 |
| Full Name | lamin B1 |
| Calculated molecular weight | 66 kDa |
| Observed molecular weight | 66-70 kDa |
| GenBank accession number | BC012295 |
| Gene Symbol | Lamin B1 |
| Gene ID (NCBI) | 4001 |
| ENSEMBL Gene ID | ENSG00000113368 |
| RRID | AB_2136290 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P20700 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Lamins are components of the nuclear lamina, a fibrous layer on the nucleoplasmic side of the inner nuclear membrane, which is thought to provide a framework for the nuclear envelope and may also interact with chromatin. The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Vertebrate lamins consist of two types, A and B. This gene encodes one of the two B type proteins, B1. Expression of uncleavable mutant lamin A or B caused significant delays in the onset of chromatin condensation and nuclear shrinkage during apoptosis (PMID:11953316). This protein is not suitable for samples where the nuclear envelope has been removed.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Lamin B1 antibody 12987-1-AP | Download protocol |
| IF protocol for Lamin B1 antibody 12987-1-AP | Download protocol |
| IHC protocol for Lamin B1 antibody 12987-1-AP | Download protocol |
| IP protocol for Lamin B1 antibody 12987-1-AP | Download protocol |
| WB protocol for Lamin B1 antibody 12987-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Human adipose and umbilical cord mesenchymal stem cell-derived extracellular vesicles mitigate photoaging via TIMP1/Notch1 | ||
Signal Transduct Target Ther Hypoxia-inducible factor upregulation by roxadustat attenuates drug reward by altering brain iron homoeostasis | ||
Signal Transduct Target Ther Serine/threonine/tyrosine kinase 1 drives pancreatic carcinogenesis via GSK3β sequestration-mediated Wnt/β-catenin pathway hyperactivation. | ||
Signal Transduct Target Ther Astragaloside IV derivative HHQ16 ameliorates infarction-induced hypertrophy and heart failure through degradation of lncRNA4012/9456 | ||
Nature Stella safeguards the oocyte methylome by preventing de novo methylation mediated by DNMT1. |