Validation Data Gallery
Tested Applications
Positive WB detected in | HepG2 cells, HL-60 cells, HEK-293 cells, mouse liver tissue, rat liver tissue |
Positive IP detected in | HepG2 cells |
Positive IHC detected in | human renal cell carcinoma tissue, human liver cancer tissue, rat heart tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:300-1:1200 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 26 publications below |
IHC | See 2 publications below |
IF | See 2 publications below |
IP | See 4 publications below |
Product Information
15904-1-AP targets MDH1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag8744 Product name: Recombinant human MDH1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-334 aa of BC001484 Sequence: MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA 相同性解析による交差性が予測される生物種 |
Full Name | malate dehydrogenase 1, NAD (soluble) |
Calculated molecular weight | 334 aa, 36 kDa |
Observed molecular weight | 36 kDa |
GenBank accession number | BC001484 |
Gene Symbol | MDH1 |
Gene ID (NCBI) | 4190 |
RRID | AB_2143279 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P40925 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
MDH1 (Malate dehydrogenase, cytoplasmic) is also named as MDHA and belongs to the LDH/MDH superfamily and MDH type 2 family which catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. It can exsit as a dimer and the dimeric MDH1 is the mitochondrial isoenzyme, whereas the tetrameric MDH2 is the glycosomal isoenzyme.(PMID:10693743)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for MDH1 antibody 15904-1-AP | Download protocol |
IHC protocol for MDH1 antibody 15904-1-AP | Download protocol |
IF protocol for MDH1 antibody 15904-1-AP | Download protocol |
IP protocol for MDH1 antibody 15904-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell An Essential Role of the Mitochondrial Electron Transport Chain in Cell Proliferation Is to Enable Aspartate Synthesis.
| ||
Cell Res The metabolite α-KG induces GSDMC-dependent pyroptosis through death receptor 6-activated caspase-8. | ||
Blood MDH1-mediated malate-aspartate NADH shuttle maintains the activity levels of fetal liver hematopoietic stem cells. | ||
J Exp Med Inhibiting both proline biosynthesis and lipogenesis synergistically suppresses tumor growth. | ||
Cell Res cMyc-mediated activation of serine biosynthesis pathway is critical for cancer progression under nutrient deprivation conditions. | ||
Nat Commun Lin28/let-7 axis regulates aerobic glycolysis and cancer progression via PDK1. |