Validation Data Gallery
Tested Applications
Positive WB detected in | HeLa cells, Caco-2 cells, SW480 cells |
Positive IP detected in | HeLa cells |
Positive IHC detected in | human stomach cancer tissue, human tonsil tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 4 publications below |
WB | See 18 publications below |
IHC | See 15 publications below |
IF | See 3 publications below |
IP | See 2 publications below |
Product Information
15520-1-AP targets MSH2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag7835 Product name: Recombinant human MSH2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 585-934 aa of BC021566 Sequence: SSGYVEPMQTLNDVLAQLDAVVSFAHVSNGAPVPYVRPAILEKGQGRIILKASRHACVEVQDEIAFIPNDVYFEKDKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISEYIATKIGAFCMFATHFHELTALANQIPTVNNLHVTALTTEETLTMLYQVKKGVCDQSFGIHVAELANFPKHVIECAKQKALELEEFQYIGESQGYDIMEPAAKKCYLEREQGEKIIQEFLSKVKQMPFTEMSEENITIKLKQLKAEVIAKNNSFVNEIISRIKVTT 相同性解析による交差性が予測される生物種 |
Full Name | mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli) |
Calculated molecular weight | 105 kDa |
Observed molecular weight | 100 kDa-105 kDa |
GenBank accession number | BC021566 |
Gene Symbol | MSH2 |
Gene ID (NCBI) | 4436 |
RRID | AB_2144799 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P43246 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
MSH2, named for its homologous to the E.coli MutS gene, takes part in DNA mismatch repair(MMR) to maintain the stability of DNA. MSH2 contains a helix-turn-helix domain, which responds for binding to DNA. Also, MSH2 has a direct role in mutation avoidance and micro-satellite stability in cell.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for MSH2 antibody 15520-1-AP | Download protocol |
IHC protocol for MSH2 antibody 15520-1-AP | Download protocol |
IF protocol for MSH2 antibody 15520-1-AP | Download protocol |
IP protocol for MSH2 antibody 15520-1-AP | Download protocol |
FC protocol for MSH2 antibody 15520-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Metab Nicotinamide metabolism face-off between macrophages and fibroblasts manipulates the microenvironment in gastric cancer | ||
Leukemia Targeting DNA polymerase β elicits synthetic lethality with mismatch repair deficiency in acute lymphoblastic leukemia
| ||
J Immunother Cancer KALRN mutations promote antitumor immunity and immunotherapy response in cancer. | ||
Cancer Lett Inhibition of KIF20A enhances the immunotherapeutic effect of hepatocellular carcinoma by enhancing c-Myc ubiquitination | ||
Hum Mol Genet Lack of association of somatic CAG repeat expansion with striatal neurodegeneration in HD knock-in animal models.
| ||
Cancer Prev Res (Phila) Estrogen stimulates the expression of mismatch repair gene hMLH1 in colonic epithelial cells. |