Validation Data Gallery
Tested Applications
| Positive WB detected in | A431 cells, SMMC-7721 cells, MCF-7 cells, rat colon tissue, HEK-293 cells, HT-29 cells, HepG2 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10442-1-AP targets P53 in WB, IHC, IF/ICC, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Cited Reactivity | human, rat, rabbit, monkey, chicken, zebrafish, sheep, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0698 Product name: Recombinant human P53 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-232 aa of BC003596 Sequence: MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTI 相同性解析による交差性が予測される生物種 |
| Full Name | tumor protein p53 |
| Calculated molecular weight | 44 kDa |
| Observed molecular weight | 53 kDa |
| GenBank accession number | BC003596 |
| Gene Symbol | P53 |
| Gene ID (NCBI) | 7157 |
| RRID | AB_2206609 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P04637 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
1. What is p53?
P53 is a tumor suppressor gene that plays a role in maintaining genomic stability and controlling apoptosis. During the cell cycle, it can arrest cells at the G1/S checkpoint and activate DNA repair mechanisms. It is the most mutated gene in cancer. In unstressed cells, p53 usually exists at low levels in an inactive form, being bound to Mdm2.
2. FAQs and p53
a. I fail to detect p53 by western blotting
Basal levels of wild-type p53 in untreated cells can be low. Try to load more cell lysate and use a positive control - a lysate of cells treated with DNA-damaging agents should increase p53 levels.
b. I fail to detect p53 in some cell lines by western blotting
Various p53 mutations are present in cancer cell types. If mutations cause truncations/deletions some monoclonal antibodies may no longer recognize mutated p53. You have more chances of detecting various p53 mutants with our polyclonal antibody.
c. I can detect more than one band ~50 kDa size / different cell lines give bands at slightly different size
p53 is a subject of post-translational modifications (http://p53.free.fr/p53_info/p53_modifications.html) and more than one isoform may be expressed (http://p53.free.fr/p53_info/p53_isoforms.html). Also, it is possible that your cell line of interest expresses one allele with mutated p53 with altered molecular weight.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for P53 antibody 10442-1-AP | Download protocol |
| IHC protocol for P53 antibody 10442-1-AP | Download protocol |
| IP protocol for P53 antibody 10442-1-AP | Download protocol |
| WB protocol for P53 antibody 10442-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Annexin A1 binds PDZ and LIM domain 7 to inhibit adipogenesis and prevent obesity | ||
Signal Transduct Target Ther Human adipose and umbilical cord mesenchymal stem cell-derived extracellular vesicles mitigate photoaging via TIMP1/Notch1 | ||
J Hematol Oncol Novel potent molecular glue degraders against broad range of hematological cancer cell lines via multiple neosubstrates degradation | ||
Mol Cancer Hsa_circ_0125356 promotes gemcitabine resistance by modulating WNT canonical and non-canonical pathways via miR-582-5p/FGF9 axis in non-small cell lung cancer | ||
Mol Cancer MiR-145, a new regulator of the DNA fragmentation factor-45 (DFF45)-mediated apoptotic network. |











