Validation Data Gallery
Tested Applications
Positive WB detected in | mouse brain tissue, C6 cells, HEK-293 cells, mouse liver tissue, PC-12 cells, rat brain tissue, pig brain tissue |
Positive IHC detected in | mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse heart tissue, mouse brain tissue |
Positive IF/ICC detected in | RAW 264.7 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:8000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 12 publications below |
WB | See 345 publications below |
IHC | See 40 publications below |
IF | See 83 publications below |
IP | See 5 publications below |
CoIP | See 6 publications below |
Product Information
14060-1-AP targets PARK2/Parkin in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
Tested Reactivity | human, mouse, rat, pig |
Cited Reactivity | human, mouse, rat, pig, rabbit, monkey, chicken, bovine, cattle, ducks |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag5092 Product name: Recombinant human Parkin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 81-387 aa of BC022014 Sequence: NATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTK 相同性解析による交差性が予測される生物種 |
Full Name | Parkinson disease (autosomal recessive, juvenile) 2, parkin |
Calculated molecular weight | 52 kDa |
Observed molecular weight | 42-52 kDa |
GenBank accession number | BC022014 |
Gene Symbol | Parkin |
Gene ID (NCBI) | 5071 |
RRID | AB_2878005 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O60260 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Parkin, a RING-type E3 ubiquitin-protein ligase, is involved in the ubiquitination pathway and contributes to protection from neurotoxicity induced by unfolded protein stresses. Its ubiquitin-protein ligase activity promotes the degradation of a variety of proteins including itself. Mutations in Parkin are implicated in the pathogenesis of autosomal recessive familial Parkinson's disease. It has 8 isoforms produced by alternative splicing with molecular weights of 24, 31, 36 and 42-52 kDa. Sometimes an additional band of 70 kDa or 110 kDa may be detected, which is caused by ubiquitination modification or formation of Parkin complex (PMID: 10976934, PMID: 18190519).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for PARK2/Parkin antibody 14060-1-AP | Download protocol |
IHC protocol for PARK2/Parkin antibody 14060-1-AP | Download protocol |
IF protocol for PARK2/Parkin antibody 14060-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Cell Biol Ammonia-induced lysosomal and mitochondrial damage causes cell death of effector CD8+ T cells | ||
Nat Commun Augmented temperature fluctuation aggravates muscular atrophy through the gut microbiota | ||
Acta Pharm Sin B Histone deacetylase inhibitors inhibit cervical cancer growth through Parkin acetylation-mediated mitophagy. | ||
Acta Pharm Sin B Engineering cannabidiol synergistic carbon monoxide nanocomplexes to enhance cancer therapy via excessive autophagy | ||
Autophagy Increased mitochondrial fission promotes autophagy and hepatocellular carcinoma cell survival through the ROS-modulated coordinated regulation of the NFKB and TP53 pathways. |