Validation Data Gallery
Tested Applications
Positive WB detected in | C2C12 cells |
Positive IP detected in | U-937 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 13 publications below |
WB | See 187 publications below |
IF | See 13 publications below |
CoIP | See 1 publications below |
ChIP | See 2 publications below |
Product Information
15540-1-AP targets PPARA in WB, IF, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, pig, chicken, bovine, hamster, goat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag7896 Product name: Recombinant human PPARA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-258 aa of BC000052 Sequence: MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPVGVCGCSGFSWQHGTSVVEDD 相同性解析による交差性が予測される生物種 |
Full Name | peroxisome proliferator-activated receptor alpha |
Calculated molecular weight | 52 kDa |
Observed molecular weight | 52 kDa |
GenBank accession number | BC000052 |
Gene Symbol | PPARA |
Gene ID (NCBI) | 5465 |
RRID | AB_2252506 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q07869 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Peroxisome proliferator-activated receptor alpha (PPARA) is a ligand-activated transcription factor that belongs to the PPAR nuclear receptor superfamily. PPARA is essential in the modulation of lipid transport and metabolism, mainly through activating mitochondrial and peroxisomal fatty acid β-oxidation pathways. In addition, PPARA seems to decrease inflammation mainly through direct interaction with NF-κB, causing inhibition of its signaling pathway or reducing the activated levels of NF-κB and subsequent inflammation. Furthermore, PPARA was implicated in the attenuation of oxidative stress in alcoholic liver disease when treated with polyenephosphatidylcholine through downregulation of ROS-generating enzymes such as ethanol-inducible cytochrome P450 2E1 (CYP2E1), acyl-CoA oxidase, and NADPH oxidase. PPARA exists two isoforms and molecular weight of PPARA isoforms are 52 kDa and 22 kDa. The ability of a retinoid X receptor (RXR) to heterodimerize with many nuclear receptors, including LXR, PPAR, NGF1B and RAR, underscores its pivotal role within the nuclear receptor superfamily. Among these heterodimers, PPAR:RXR is considered an important signalling mediator of both PPAR ligands, such as fatty acids, and 9-cis retinoic acid (9-cis RA), an RXR ligand. (PMID: 15103326 ). PPARA can form Heterodimer with RXRA and molecular weight of Heterodimer is about 110 kDa.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for PPARA antibody 15540-1-AP | Download protocol |
IP protocol for PPARA antibody 15540-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Commun Hyodeoxycholic acid ameliorates nonalcoholic fatty liver disease by inhibiting RAN-mediated PPARα nucleus-cytoplasm shuttling | ||
Sci Adv Small-molecule inhibitor targeting orphan nuclear receptor COUP-TFII for prostate cancer treatment. | ||
Hepatology The histone methyltransferase Suv39h2 contributes to nonalcoholic steatohepatitis in mice. | ||
Nat Commun N1-methyladenosine methylation in tRNA drives liver tumourigenesis by regulating cholesterol metabolism. | ||