Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, Jurkat cells, NIH/3T3 cells, J774A.1 cells, RAW 264.7 cells, PC-12 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 15 publications below |
| WB | See 410 publications below |
| IHC | See 17 publications below |
| IF | See 19 publications below |
| IP | See 4 publications below |
| ELISA | See 1 publications below |
| ChIP | See 1 publications below |
Product Information
10929-2-AP targets AMPK Alpha in WB, IHC, IF/ICC, IP, ChIP, ELISA, Western Blot applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, pig, chicken, bovine, goat, fish, carp, duck |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1367 Product name: Recombinant human AMPK alpha protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-207 aa of BC012622 Sequence: MATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRDCNIIRILTSQFTNYQH 相同性解析による交差性が予測される生物種 |
| Full Name | protein kinase, AMP-activated, alpha 1 catalytic subunit |
| Calculated molecular weight | 63 kDa |
| Observed molecular weight | 64 kDa |
| GenBank accession number | BC012622 |
| Gene Symbol | AMPK Alpha 1 |
| Gene ID (NCBI) | 5562 |
| RRID | AB_2169568 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13131 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
The mammalian 5-prime-AMP-activated protein kinase (AMPK) appears to play a role in protecting cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. PRKAA1 is also named as AMPK1, ACACA kinase, HMGCR kinase. It is a mammalian homologue of sucrose non-fermenting protein kinase (SNF-1), which belongs to a serine/threonine protein kinase family. It has 2 isoforms with molecular mass of 63-66 kDa produced by alternative splicing.10929-2-AP can recognize both AMPK Alpha 1 and AMPK Alpha 2.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for AMPK Alpha antibody 10929-2-AP | Download protocol |
| IHC protocol for AMPK Alpha antibody 10929-2-AP | Download protocol |
| IP protocol for AMPK Alpha antibody 10929-2-AP | Download protocol |
| WB protocol for AMPK Alpha antibody 10929-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Glibenclamide targets MDH2 to relieve aging phenotypes through metabolism-regulated epigenetic modification | ||
Adv Sci (Weinh) Mitigating Doxorubicin-Induced Cardiotoxicity and Enhancing Anti-Tumor Efficacy with a Metformin-Integrated Self-Assembled Nanomedicine | ||
Adv Sci (Weinh) POSTN-Mediated Interplay of M1 Polarized Macrophage with Tendon-Derived Stem Cells to Drive Traumatic Heterotopic Ossification Formation through PTK7/ATK Signaling | ||
Autophagy Periplocin suppresses the growth of colorectal cancer cells by triggering LGALS3 (galectin 3)-mediated lysophagy | ||
Autophagy The AMPK-MFN2 axis regulates MAM dynamics and autophagy induced by energy stresses.
|





