Validation Data Gallery
Tested Applications
Positive WB detected in | K-562 cells, HEK-293 cells, human brain tissue, NIH/3T3 cells, U-937 cells |
Positive IP detected in | K-562 cells |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 6 publications below |
WB | See 14 publications below |
IHC | See 5 publications below |
IF | See 3 publications below |
CoIP | See 2 publications below |
ChIP | See 1 publications below |
Product Information
16031-1-AP targets RNF2 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag8900 Product name: Recombinant human RNF2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-336 aa of BC012583 Sequence: MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK 相同性解析による交差性が予測される生物種 |
Full Name | ring finger protein 2 |
Calculated molecular weight | 336 aa, 38 kDa |
Observed molecular weight | 38 kDa |
GenBank accession number | BC012583 |
Gene Symbol | RNF2 |
Gene ID (NCBI) | 6045 |
RRID | AB_2180459 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q99496 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
RNF2 (also known as ding, Ring1B or Ring2) is a member of the Ring finger protein family, which functions as E3 ubiquitin ligase for monoubiquitination of histone H2A at lysine 119 (H2AK119ub). Many studies have demonstrated that overexpressed RNF2 was involved in the pathological progression of multiple cancers and has an impact on their clinical features. For instance, the upregulated expression level of RNF2 is positively correlated with the occurrence and progression of hepatocellular carcinoma, melanoma, prostate cancer, breast cancer, pancreatic cancer, gastric cancer, and bladder urothelial carcinoma, as well as with the radioresistance of lung cancer and chemoresistance of ovarian cancer (PMID: 33400276). The molecular weight of RNF2 is 38 kDa.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for RNF2 antibody 16031-1-AP | Download protocol |
IF protocol for RNF2 antibody 16031-1-AP | Download protocol |
IP protocol for RNF2 antibody 16031-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cancer Cell Coordinated regulation of polycomb group complexes through microRNAs in cancer.
| ||
Cancer Cell The Polycomb Repressor Complex 1 Drives Double-Negative Prostate Cancer Metastasis by Coordinating Stemness and Immune Suppression.
| ||
Dev Cell Nucleoporin Seh1 controls murine neocortical development via transcriptional repression of p21 in neural stem cells | ||
J Cell Biol DUX4-induced HSATII transcription causes KDM2A/B-PRC1 nuclear foci and impairs DNA damage response
| ||
FEBS J Radiation resistance of cancer cells caused by mitochondrial dysfunction depends on SIRT3-mediated mitophagy | ||
Front Cell Dev Biol RNF2 Mediates Hepatic Stellate Cells Activation by Regulating ERK/p38 Signaling Pathway in LX-2 Cells.
|