Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, L02 cells, MCF-7 cells, mouse liver tissue, rat liver tissue |
| Positive IP detected in | L02 cells |
| Positive IHC detected in | human kidney tissue, human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 12 publications below |
| WB | See 270 publications below |
| IHC | See 37 publications below |
| IF | See 29 publications below |
| IP | See 2 publications below |
| CoIP | See 2 publications below |
| ChIP | See 7 publications below |
Product Information
14088-1-AP targets SREBF1 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, monkey, chicken, bovine, sheep, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5219 Product name: Recombinant human SREBF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-332 aa of BC063281 Sequence: MDEPPFSEAALEQALGEPCDLDAALLTDIEGEVGAGRGRANGLDAPRAGADRGAMDCTFEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEK 相同性解析による交差性が予測される生物種 |
| Full Name | sterol regulatory element binding transcription factor 1 |
| Calculated molecular weight | 1177 aa, 125 kDa |
| Observed molecular weight | 125 kDa, 68 kDa |
| GenBank accession number | BC063281 |
| Gene Symbol | SREBF1 |
| Gene ID (NCBI) | 6720 |
| RRID | AB_2255217 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P36956 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
SREBF1, also named as BHLHD1 and SREBP1, contains one basic helix-loop-helix (bHLH) domain and belongs to the SREBP family. It is a transcriptional activator required for lipid homeostasis. The SREBPs are synthesized as precursors anchored to endoplasmic reticulum (ER) membranes and complexed with SCAP. When the cellular cholesterol level is low, SREBP-SCAP complexes move to the Golgi apparatus, where SREBPs undergo a two-step proteolytic processing, leading to the release of the mature form, an N-terminal fragment, i.e, basic helix-loop-helix leucine zipper transcription factor. These factors enter the nucleus where they bind to sterol regulatory elements (SRE) in the promoter regions of a number of genes whose products mediate the synthesis of cholesterol and fatty acids. [PMID: 21698267]. This antibody can recognize the 125 kDa precursor form and the 68 kDa mature form of human SREBF1.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SREBF1 antibody 14088-1-AP | Download protocol |
| IHC protocol for SREBF1 antibody 14088-1-AP | Download protocol |
| IP protocol for SREBF1 antibody 14088-1-AP | Download protocol |
| WB protocol for SREBF1 antibody 14088-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cancer Cell KMT2C deficiency drives transdifferentiation of double-negative prostate cancer and confer resistance to AR-targeted therapy | ||
Cell Metab CircACC1 Regulates Assembly and Activation of AMPK Complex under Metabolic Stress.
| ||
Cell Metab TMEM41B acts as an ER scramblase required for lipoprotein biogenesis and lipid homeostasis. | ||
Nat Commun Senescence-associated 13-HODE production promotes age-related liver steatosis by directly inhibiting catalase activity |













