Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, Jurkat cells, RAW 264.7 cells, rat brain tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human cervical cancer tissue, human endometrial cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 96 publications below |
| IHC | See 8 publications below |
| IF | See 16 publications below |
| IP | See 3 publications below |
| CoIP | See 2 publications below |
Product Information
60199-1-Ig targets STAT3 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, zebrafish, bovine |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0360 Product name: Recombinant human STAT3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 2-219 aa of BC000627 Sequence: AQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVS 相同性解析による交差性が予測される生物種 |
| Full Name | signal transducer and activator of transcription 3 (acute-phase response factor) |
| Calculated molecular weight | 770 aa, 88 kDa |
| Observed molecular weight | 85-88 kDa |
| GenBank accession number | BC000627 |
| Gene Symbol | STAT3 |
| Gene ID (NCBI) | 6774 |
| RRID | AB_10913811 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P40763 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3, synonyms: APRF, FLJ20882, MGC16063) is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. STAT3 is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. STAT3 mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of STAT3. This antibody is a mouse monoclonal antibody raised against residues near the N terminus of human STAT3. STAT3 exists three isoforms and the molecular weight of each isoform respectively is 83 kDa, 87 kDa and 88 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for STAT3 antibody 60199-1-Ig | Download protocol |
| IHC protocol for STAT3 antibody 60199-1-Ig | Download protocol |
| IP protocol for STAT3 antibody 60199-1-Ig | Download protocol |
| WB protocol for STAT3 antibody 60199-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
ACS Nano Dual Inhibition of Endoplasmic Reticulum Stress and Oxidation Stress Manipulates the Polarization of Macrophages under Hypoxia to Sensitize Immunotherapy. | ||
J Immunother Cancer Switch receptor T3/28 improves long-term persistence and antitumor efficacy of CAR-T cells | ||
Theranostics Combination therapy with ropivacaine-loaded liposomes and nutrient deprivation for simultaneous cancer therapy and cancer pain relief. | ||
Clin Transl Med PRKAR2A-derived circular RNAs promote the malignant transformation of colitis and distinguish patients with colitis-associated colorectal cancer. | ||
Elife Upregulated expression of ubiquitin ligase TRIM21 promotes PKM2 nuclear translocation and astrocyte activation in experimental autoimmune encephalomyelitis |









