Validation Data Gallery
Tested Applications
Positive WB detected in | A549 cells, PC-3 cells |
Positive IHC detected in | human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | A549 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 4 publications below |
IF | See 3 publications below |
Product Information
11571-1-AP targets TFG in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2151 Product name: Recombinant human TFG protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-400 aa of BC023599 Sequence: MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPSAPAEDRSGTPDSIASSSSAAHPPGVQPQQPPYTGAQTQAGQIEGQMYQQYQQQAGYGAQQPQAPPQQPQQYGIQYSASYSQQTGPQQPQQFQGYGQQPTSQAPAPAFSGQPQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMAPSQPGAYQPRPGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQPGPGYR 相同性解析による交差性が予測される生物種 |
Full Name | TRK-fused gene |
Calculated molecular weight | 400 aa, 43 kDa |
Observed molecular weight | 50-55 kDa |
GenBank accession number | BC023599 |
Gene Symbol | TFG |
Gene ID (NCBI) | 10342 |
RRID | AB_2203102 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q92734 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Protein TFG (TRK-fused gene protein) plays a role in regulating phosphotyrosine-specific phosphatase-1 activity. Mutations in TFG may have important clinical relevance for current therapeutic strategies to treat metastatic melanoma. Defects in TFG are a cause of thyroid papillary carcinoma (TPC), a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue. Hereditary motor and sensory neuropathy with proximal dominant involvement (HMSN-P) is an autosomal-dominant neurodegenerative disorder characterized by widespread fasciculations, proximal-predominant muscle weakness, and atrophy followed by distal sensory involvement. Recent genetic investigation indicates that formation of TFG-containing cytoplasmic inclusions and concomitant mislocalization of TAR DNA-binding protein 43 kDa (TDP-43) underlie motor neuron degeneration in HMSN-P. Pathological overlap of proteinopathies involving TFG and TDP-43 highlights a new pathway leading to motor neuron degeneration.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TFG antibody 11571-1-AP | Download protocol |
IHC protocol for TFG antibody 11571-1-AP | Download protocol |
IF protocol for TFG antibody 11571-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Res A new type of ERGIC-ERES membrane contact mediated by TMED9 and SEC12 is required for autophagosome biogenesis.
| ||
Redox Biol Selenoprotein K contributes to CD36 subcellular trafficking in hepatocytes by accelerating nascent COPII vesicle formation and aggravates hepatic steatosis | ||
Neurobiol Dis Evidence of TRK-Fused Gene (TFG1) function in the ubiquitin-proteasome system.
| ||
J Med Genet Novel TFG mutation causes autosomal-dominant spastic paraplegia and defects in autophagy | ||
Muscle Nerve Muscle pathology of hereditary motor and sensory neuropathy with proximal dominant involvement with TFG mutation. | ||
Commun Biol A pore-forming protein drives macropinocytosis to facilitate toad water maintaining. |