Validation Data Gallery
Tested Applications
Positive WB detected in | A431 cells, Jurkat cells, MCF-7 cells, K-562 cells, Hek-293 cells, HeLa cells, Raji cells, NIH/3T3 cells |
Positive IP detected in | HeLa cells |
Positive IHC detected in | human breast cancer tissue, human colon tissue, human liver cancer tissue, human stomach tissue, mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells, TNF alpha treated HT-1080 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:6000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
10745-1-AP targets NF-κB p65 in WB, IHC, IF/ICC, IP, CoIP, chIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, rabbit, monkey, chicken, zebrafish, sheep, goat, fish |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag1199 Product name: Recombinant human p65; RELA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-220 aa of BC011603 Sequence: MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQ 相同性解析による交差性が予測される生物種 |
Full Name | v-rel reticuloendotheliosis viral oncogene homolog A (avian) |
Calculated molecular weight | 65 kDa |
Observed molecular weight | 65 kDa |
GenBank accession number | BC011603 |
Gene Symbol | NF-κB p65 |
Gene ID (NCBI) | 5970 |
RRID | AB_2178878 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q04206 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Nuclear factor k B (NF-kB) is a sequence-specific DNA-binding protein complex which regulates the expression of viral genomes, including the human immunodeficiency virus, and a variety of cellular genes, particularly those involved in immune and inflammatory responses. The members of the NF-kB family in mammalian cells include the proto-oncogene c-Rel,p50/p105 (NFkB1), p65 (RelA), p52/p100 (NFkB2), and RelB. All of these proteins share a conserved 300-amino acid region known as the Rel homology domain which is responsible for DNA binding, dimerization, and nuclear translocation of NF-kB. The p65 subunit is a major component of NF-kB complexes and is responsible for trans-activation. NF-kB heterodimeric p65-p50 and p65-c-Rel complexes are transcriptional activators. The NF-kB p65-p65 complex appears to be involved in invasin-mediated activation of IL-8 expression. The inhibitory effect of IkB upon NF-kB the cytoplasm is exerted primarily through the interaction with p65. p65 shows a weak DNA-binding site which could contribute directly to DNA binding in the NF-kB complex. It associates with chromatin at the NF-kB promoter region via association with DDX1. This antibody is a rabbit polyclonal antibody raised against residues near the N terminus of human RELA.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for NF-κB p65 antibody 10745-1-AP | Download protocol |
IHC protocol for NF-κB p65 antibody 10745-1-AP | Download protocol |
IF protocol for NF-κB p65 antibody 10745-1-AP | Download protocol |
IP protocol for NF-κB p65 antibody 10745-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Bioact Mater Silicate ions as soluble form of bioactive ceramics alleviate aortic aneurysm and dissection | ||
Mol Cell Serine synthesis sustains macrophage IL-1β production via NAD+-dependent protein acetylation | ||
Nat Microbiol IFI16 directly senses viral RNA and enhances RIG-I transcription and activation to restrict influenza virus infection. | ||
Adv Sci (Weinh) Sirtuin 5-Mediated Desuccinylation of ALDH2 Alleviates Mitochondrial Oxidative Stress Following Acetaminophen-Induced Acute Liver Injury |