Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, LNCaP cells, THP-1 cells |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human skin cancer tissue, human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11714-1-AP targets IFITM3 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, pig, canine, monkey, chicken, goat, african green monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2285 Product name: Recombinant human IFITM3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-133 aa of BC006794 Sequence: MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG 相同性解析による交差性が予測される生物種 |
| Full Name | interferon induced transmembrane protein 3 (1-8U) |
| Calculated molecular weight | 133 aa, 15 kDa |
| Observed molecular weight | 14 kDa |
| GenBank accession number | BC006794 |
| Gene Symbol | IFITM3 |
| Gene ID (NCBI) | 10410 |
| RRID | AB_2295684 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q01628 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
IFITM3, also named as interferon-inducible protein 1-8U, belongs to the CD225 family. It is IFN-induced antiviral protein that mediates cellular innate immunity to at least three major human pathogens, namely influenza A H1N1 virus, West Nile virus (WNV), and dengue virus, by inhibiting the early steps of replication. IFITM3 is identified as interferon-induced cellular proteins that restrict infections by retroviruses and filoviruses and of influenza virus and flaviviruses, respectively. IFITM3, the most potent antiviral IFITM, was found to inhibit an uncharacterized early infectious event after VSV endocytosis, but before primary transcription of its viral genome. IFITM proteins are viral restriction factors that can inhibit infection mediated by the influenza A virus (IAV) hemagglutinin (HA) protein. They differentially restrict the entry of a broad range of enveloped viruses, and modulate cellular tropism independently of viral receptor expression. Catalog#11714-1-AP is a rabbit polyclonal antibody raised against the full-length of human IFITM3.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for IFITM3 antibody 11714-1-AP | Download protocol |
| IHC protocol for IFITM3 antibody 11714-1-AP | Download protocol |
| IP protocol for IFITM3 antibody 11714-1-AP | Download protocol |
| WB protocol for IFITM3 antibody 11714-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Science T cell memory. Skin-resident memory CD8⁺ T cells trigger a state of tissue-wide pathogen alert. | ||
Science A human apolipoprotein L with detergent-like activity kills intracellular pathogens. | ||
Cell A family of conserved bacterial virulence factors dampens interferon responses by blocking calcium signaling. | ||





