Validation Data Gallery
Tested Applications
Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells, mouse kidney tissue, rat kidney tissue |
Positive IP detected in | mouse liver tissue |
Positive IHC detected in | human liver tissue, mouse heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells, HeLa cells |
Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 4 publications below |
WB | See 94 publications below |
IHC | See 1 publications below |
IF | See 22 publications below |
IP | See 2 publications below |
CoIP | See 3 publications below |
Product Information
18409-1-AP targets TOMM40 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, monkey, bovine |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag13065 Product name: Recombinant human TOMM40 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-361 aa of BC017224 Sequence: MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG 相同性解析による交差性が予測される生物種 |
Full Name | translocase of outer mitochondrial membrane 40 homolog (yeast) |
Calculated molecular weight | 38 kDa |
Observed molecular weight | 38 kDa |
GenBank accession number | BC017224 |
Gene Symbol | TOMM40 |
Gene ID (NCBI) | 10452 |
RRID | AB_2303725 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O96008 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
The translocase of outer mitochondria membrane 40 (TOMM40, also known as TOM40), located in the center of the TOM complex, is a channel-forming subunit of translocase. It can facilitate the fluid movement of preproteins into the mitochondria by associating with TOMM20. TOMM40 plays a role in the assembly of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) by forming a complex with BCAP31 and mediating the translocation of Complex I components from the cytosol to the mitochondria (PMID: 31206022). TOMM40 has been reported to be associated with late-onset neurodegenerative diseases such as Alzheimer's disease and Parkinson's disease.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TOMM40 antibody 18409-1-AP | Download protocol |
IHC protocol for TOMM40 antibody 18409-1-AP | Download protocol |
IF protocol for TOMM40 antibody 18409-1-AP | Download protocol |
IP protocol for TOMM40 antibody 18409-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nature In vivo imaging of mitochondrial membrane potential in non-small-cell lung cancer. | ||
Cell Tau interactome maps synaptic and mitochondrial processes associated with neurodegeneration. | ||
Cell Discov The Fe-S cluster assembly protein IscU2 increases α-ketoglutarate catabolism and DNA 5mC to promote tumor growth | ||
Cell Metab Quantitative high-confidence human mitochondrial proteome and its dynamics in cellular context.
| ||
Nat Cell Biol MIROs and DRP1 drive mitochondrial-derived vesicle biogenesis and promote quality control. |