Validation Data Gallery
Tested Applications
| Positive WB detected in | Jurkat cells |
| Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human breast cancer tissue |
| Positive IF/ICC detected in | Ramos cells |
| Positive FC (Intra) detected in | Ramos cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 52 publications below |
| IHC | See 25 publications below |
| IF | See 14 publications below |
| ELISA | See 4 publications below |
Product Information
66142-1-Ig targets IL-4 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, pig samples.
| Tested Reactivity | human, pig |
| Cited Reactivity | human, mouse, rat, pig, bovine |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9940 Product name: Recombinant human IL-4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 24-153 aa of BC070123 Sequence: GHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS 相同性解析による交差性が予測される生物種 |
| Full Name | interleukin 4 |
| Calculated molecular weight | 153 aa, 17 kDa |
| Observed molecular weight | 18 kDa |
| GenBank accession number | BC070123 |
| Gene Symbol | IL-4 |
| Gene ID (NCBI) | 3565 |
| RRID | AB_2881539 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P05112 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
IL4 is a cytokine produced by CD4+ T cells in response to helminthes and other extracellular parasites. It promotes the proliferation and differentiation of antigen presenting cells. IL4 also plays a pivotal role in antibody isotype switching and stimulates the production of IgE. This cytokine has been applied in the treatment of autoimmune disorder like multiple myeloma, cancer, psoriasis, and arthritis. IL4 has also been extensively applied to inhibit detrimental effect of Th1. It may promote the growth of epithelial tumors by mediating increased proliferation and survival.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for IL-4 antibody 66142-1-Ig | Download protocol |
| IF protocol for IL-4 antibody 66142-1-Ig | Download protocol |
| IHC protocol for IL-4 antibody 66142-1-Ig | Download protocol |
| WB protocol for IL-4 antibody 66142-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Mater Multifunctional Injectable Hydrogel as a Biomimic Lens: Optical-Mechanical Restoration and Dynamic Postoperative Microenvironment Regulation. | ||
Sci Transl Med Immune checkpoint B7-H3 is a therapeutic vulnerability in prostate cancer harboring PTEN and TP53 deficiencies | ||
J Nanobiotechnology A novel multifunctional nanocomposite hydrogel orchestrates the macrophage reprogramming-osteogenesis crosstalk to boost bone defect repair | ||
J Nanobiotechnology Microglia-specific interleukin-4 delivery by engineered extracellular vesicles restores inner blood-retinal barrier in diabetic retinopathy via GAS6-MERTK pathway. | ||
Adv Sci (Weinh) SMYD3 Promotes Immune Evasion in Clear Cell Renal Cell Carcinoma via SREBP1-Mediated Transactivation of CD47 |