Validation Data Gallery
Tested Applications
| Positive WB detected in | K-562 cells, HCT 116 cells, K562, NCI-H1299 cells |
| Positive IHC detected in | human pancreas cancer tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 67 publications below |
| IHC | See 3 publications below |
| IF | See 2 publications below |
Product Information
60246-1-Ig targets 4EBP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, pig samples.
| Tested Reactivity | human, pig |
| Cited Reactivity | human, chicken |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18985 Product name: Recombinant human 4EBP1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-118 aa of BC004459 Sequence: MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI 相同性解析による交差性が予測される生物種 |
| Full Name | eukaryotic translation initiation factor 4E binding protein 1 |
| Calculated molecular weight | 118 aa, 12 kDa |
| Observed molecular weight | 15-24 kDa |
| GenBank accession number | BC004459 |
| Gene Symbol | EIF4EBP1 |
| Gene ID (NCBI) | 1978 |
| RRID | AB_2881368 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q13541 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Eukaryotic translation initiation factor 4E-binding protein 1(4EBP1), is a member of 4EBPs family, which regulate the translation of a subset of mRNA by competing with eIF4G for binding to eIF4E, thus preventing the assembly of the eIF4F complex. The eIF4F facilitates the recruitment of other translation initiation factors to form the complex and then initiates cap-dependent translation.4EBP1 also mediates the regulation of protein translation by growth factors, hormones and other stimuli that signal through the MAP kinase and mTORC1 pathways. There are three forms of 4EBP1, alpha, beta and gamma.typical pattern seen on Western blots for phosphorylated heat-acid stabled protein 4EBP1 from rat gastrocnemius muscle. Three distinct bands are noted, with the most rapidly migrating band having an apparent molecular mass of ; 20 kDa and the slowest migrating band of; 24 kDa. The 3 bands are designated by convention as alpha, beta and gamma. (PMID: 10913029)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for 4EBP1 antibody 60246-1-Ig | Download protocol |
| IHC protocol for 4EBP1 antibody 60246-1-Ig | Download protocol |
| WB protocol for 4EBP1 antibody 60246-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Hepatol OGDHL silencing promotes hepatocellular carcinoma by reprogramming glutamine metabolism. | ||
Mol Cancer The circular RNA circ-ERBIN promotes growth and metastasis of colorectal cancer by miR-125a-5p and miR-138-5p/4EBP-1 mediated cap-independent HIF-1α translation. | ||
Sci Adv Citrulline regulates macrophage metabolism and inflammation to counter aging in mice | ||
Cell Death Differ Lysine methylation of PPP1CA by the methyltransferase SUV39H2 disrupts TFEB-dependent autophagy and promotes intervertebral disc degeneration | ||
Autophagy STYK1 promotes autophagy through enhancing the assembly of autophagy-specific class III phosphatidylinositol 3-kinase complex I. |








