Validation Data Gallery
Tested Applications
Positive WB detected in | human placenta tissue |
Positive IHC detected in | human breast cancer tissue, human tonsillitis tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | human placenta tissue |
Positive IF/ICC detected in | HUVEC cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:6000 |
Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:750-1:3000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 25 publications below |
IHC | See 4 publications below |
IF | See 10 publications below |
Product Information
66804-1-Ig targets VE-cadherin/CD144 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag27501 Product name: Recombinant human CDH5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 54-241 aa of NM_001795 Sequence: MHIDEEKNTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETPSSFTIKVHDVNDNWPVFTHRLFNASVPESSAVGTSVISVTAVDADDPTVGDHASVMYQILKGKEYFAIDNSGRIITITKSLDREKQARYEIVVEARDAQGLRGDSGT 相同性解析による交差性が予測される生物種 |
Full Name | cadherin 5, type 2 (vascular endothelium) |
Calculated molecular weight | 88 kDa |
Observed molecular weight | 125 kDa, 100 kDa |
GenBank accession number | NM_001795 |
Gene Symbol | VE-cadherin |
Gene ID (NCBI) | 1003 |
RRID | AB_2882147 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P33151 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Cadherins are a family of transmembrane glycoproteins that mediate calcium-dependent cell-cell adhesion and play an important role in the maintenance of normal tissue architecture. Vascular endothelial cadherin (VE-cadherin), also known as Cadherin-5 (CDH5) or CD144, is a member of the type II classical cadherin family of cell adhesion proteins (PMID: 21269602). VE-cadherin is expressed specifically in endothelial cells and mediates homophilic adhesion in the vascular endothelium (PMID: 1522121; 8555485; 21269602). VE-cadherin plays a role in the organization of lateral endothelial junctions and in the control of permeability properties of vascular endothelium (PMID: 1522121). VE-cadherin has also been shown to be required for angiogenesis (PMID: 16473763; 18162609).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for VE-cadherin/CD144 antibody 66804-1-Ig | Download protocol |
IHC protocol for VE-cadherin/CD144 antibody 66804-1-Ig | Download protocol |
IF protocol for VE-cadherin/CD144 antibody 66804-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Acta Pharmacol Sin Endothelial deubiquinatase YOD1 mediates Ang II-induced vascular endothelial-mesenchymal transition and remodeling by regulating β-catenin | ||
EMBO Rep Mouse endothelial OTUD1 promotes angiotensin II-induced vascular remodeling by deubiquitinating SMAD3 | ||
Biomed Pharmacother Ginsenoside Rg1 ameliorates hypoxia-induced pulmonary arterial hypertension by inhibiting endothelial-to-mesenchymal transition and inflammation by regulating CCN1 | ||
Regen Biomater Microvascular network based on the Hilbert curve for nutrient transport in thick tissue | ||
J Invest Dermatol Endothelial Piezo1 mediates barrier dysfunction and NLRP3 inflammasomes activation in psoriasis | ||
J Cell Mol Med Adrenomedullin Inhibits the Efficacy of Combined Immunotherapy and Targeted Therapy in Biliary Tract Cancer by Disrupting Endothelial Cell Functions |