Validation Data Gallery
Tested Applications
Positive WB detected in | HEK-293 cells, mouse brain tissue, K-562 cells, Raji cells, C2C12 cells, C6 cells, PC-12 cells |
Positive IP detected in | mouse brain tissue |
Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells, HEK-293 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 9 publications below |
IHC | See 1 publications below |
IF | See 12 publications below |
IP | See 1 publications below |
Product Information
10852-1-AP targets CLTA in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, canine, monkey |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag1299 Product name: Recombinant human CLTA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-218 aa of BC019287 Sequence: MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH 相同性解析による交差性が予測される生物種 |
Full Name | clathrin, light chain (Lca) |
Calculated molecular weight | 27 kDa |
Observed molecular weight | 35-38 kDa |
GenBank accession number | BC019287 |
Gene Symbol | CLTA |
Gene ID (NCBI) | 1211 |
RRID | AB_2083025 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P09496 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Clathrin is the major protein of the polyhedral coat of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. The clathrin molecule has a triskelion shape. Each clathrin triskelion is composed of three identical heavy chains (180 kDa) and three light chains of two types, LCA (CLTA) and LCB (CLTB) (30-40 kDa). The light chain subunits are thought to regulate the formation or disassembly of clathrin coats. (PMID: 2445759; 8374173; 3563513)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CLTA antibody 10852-1-AP | Download protocol |
IHC protocol for CLTA antibody 10852-1-AP | Download protocol |
IF protocol for CLTA antibody 10852-1-AP | Download protocol |
IP protocol for CLTA antibody 10852-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Commun Imaging vesicle formation dynamics supports the flexible model of clathrin-mediated endocytosis. | ||
Proc Natl Acad Sci U S A Clathrin light chains' role in selective endocytosis influences antibody isotype switching.
| ||
J Cell Biol Alternative splicing of clathrin heavy chain contributes to the switch from coated pits to plaques. | ||
Small Persistency of Enlarged Autolysosomes Underscores Nanoparticle-Induced Autophagy in Hepatocytes. | ||
Acta Pharmacol Sin GPR97 deficiency ameliorates renal interstitial fibrosis in mouse hypertensive nephropathy | ||
J Bone Miner Res Adaptor protein complex 2-mediated, clathrin-dependent endocytosis, and related gene activities, are a prominent feature during maturation stage amelogenesis. |