Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse heart tissue, human heart tissue, rat heart tissue |
| Positive IP detected in | mouse heart tissue |
| Positive IHC detected in | human appendicitis tissue, human colon tissue, human heart tissue, human hysteromyoma tissue, human placenta tissue, human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat heart tissue, mouse heart tissue |
| Positive IF/ICC detected in | C2C12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:20000-1:100000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:4000-1:16000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 60 publications below |
| IHC | See 16 publications below |
| IF | See 56 publications below |
| IP | See 3 publications below |
Product Information
16520-1-AP targets Desmin in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, monkey, chicken, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9742 Product name: Recombinant human Desmin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 121-470 aa of BC032116 Sequence: NYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL 相同性解析による交差性が予測される生物種 |
| Full Name | desmin |
| Calculated molecular weight | 470 aa, 54 kDa |
| Observed molecular weight | 52-53 kDa |
| GenBank accession number | BC032116 |
| Gene Symbol | Desmin |
| Gene ID (NCBI) | 1674 |
| RRID | AB_2292918 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P17661 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Desmin is the main intermediate filament protein in skeletal and cardiac muscle cells and is essential for both the structural integrity and the survival of muscle cells. As an abundant muscle-specific protein, desmin has been widely used as a marker of muscle derived tumors. Anti-desmin is also valuable in the differential diagnosis of tumors of uncertain origin.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Desmin antibody 16520-1-AP | Download protocol |
| IHC protocol for Desmin antibody 16520-1-AP | Download protocol |
| IP protocol for Desmin antibody 16520-1-AP | Download protocol |
| WB protocol for Desmin antibody 16520-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther The AKAP12-PKA axis regulates lipid homeostasis during alcohol-associated liver disease | ||
Cell Selective targeting of endothelial and perivascular angiocrine ROCK2 treats liver fibrosis. | ||
Cell Metab Muscle-derived small extracellular vesicles induce liver fibrosis during overtraining | ||
Mil Med Res Single-cell transcriptomic dissection of the cellular and molecular events underlying the triclosan-induced liver fibrosis in mice | ||
Nat Commun Vesicle-associated membrane protein 5 is an intrinsic defense factor for embryonic stem cells against coronaviruses | ||
J Adv Res Podocyte TLR4 deletion alleviates diabetic kidney disease through prohibiting PKCδ/SHP-1-dependent ER stress and relieving podocyte damage and inflammation |