Validation Data Gallery
Tested Applications
Positive WB detected in | THP-1 cells, A431 cells, U-87 MG cells |
Positive IHC detected in | human lung cancer tissue, human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | LPS treated THP-1 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 83 publications below |
IHC | See 13 publications below |
IF | See 11 publications below |
IP | See 1 publications below |
ELISA | See 2 publications below |
Product Information
66737-1-Ig targets IL-1 beta in WB, IHC, IF/ICC, IP, ELISA, Cell treatment applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, rabbit, bovine |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26030 Product name: Recombinant human IL-1B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 117-269 aa of BC008678 Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS 相同性解析による交差性が予測される生物種 |
Full Name | interleukin 1, beta |
Calculated molecular weight | 269 aa, 31 kDa |
Observed molecular weight | 35 kDa |
GenBank accession number | BC008678 |
Gene Symbol | IL1B |
Gene ID (NCBI) | 3553 |
ENSEMBL Gene ID | ENSG00000125538 |
RRID | AB_2882087 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P01584 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Interleukin-1 is a pro-inflammatory cytokine with multiple biological effects. The IL-1 gene family encodes three proteins: IL-1α, IL-1β and their naturally occurring inhibitor Il-1RN. IL-1 Beta(IL-1β), mainly produced by blood monocytes and tissue macrophages, has been implicated in mediating both acute and chronic inflammation. IL-1β is known to be involved in a variety of cellular activities, including cell proliferation, differentiation and apoptosis. IL-1β is emerging as a key mediator of carcinogenesis that characterizes host-environment interactions. Human IL-1β is synthesized as a 31 kDa precursor. To gain activity, the precursor must be cleaved by caspase-1 between Asp116 and Ala117 to yield a 17 kDa mature form.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for IL-1 beta antibody 66737-1-Ig | Download protocol |
IHC protocol for IL-1 beta antibody 66737-1-Ig | Download protocol |
IF protocol for IL-1 beta antibody 66737-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Metab Lighting up arginine metabolism reveals its functional diversity in physiology and pathology | ||
Adv Mater Noninvasive Optogenetics Realized by iPSC-Derived Tentacled Carrier in Alzheimer's Disease Treatment | ||
Biomaterials Macromechanics and polycaprolactone fiber organization drive macrophage polarization and regulate inflammatory activation of tendon in vitro and in vivo. | ||
J Nanobiotechnology Low-dose celecoxib-loaded PCL fibers reverse intervertebral disc degeneration by up-regulating CHSY3 expression | ||
J Nanobiotechnology Implantation of biomimetic polydopamine nanocomposite scaffold promotes optic nerve regeneration through modulating inhibitory microenvironment | ||
Cell Mol Life Sci circACTA2 inhibits NLRP3 inflammasome-mediated inflammation via interacting with NF-κB in vascular smooth muscle cells |