Validation Data Gallery
Tested Applications
| Positive IF-P detected in | rat brain tissue | 
| Positive FC (Intra) detected in | Neuro-2a cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 | 
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-17490 targets MAP2 in IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | mouse | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | CatNo: Ag11580 Product name: Recombinant human MAP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 213-559 aa of BC038857 Sequence: TSAGSTDRLPYSKSGNKDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGSTDNIKYQPKGGQVRILNKKIDFSKVQSRCGSKDNIKHSAGGGNVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSNVSSSGSINLLESPQLATLAEDVTAALAKQGL相同性解析による交差性が予測される生物種 | 
| Full Name | microtubule-associated protein 2 | 
| Calculated molecular weight | 200 kDa | 
| Observed molecular weight | |
| GenBank accession number | BC038857 | 
| Gene Symbol | MAP2 | 
| Gene ID (NCBI) | 4133 | 
| RRID | AB_2919149 | 
| Conjugate | CoraLite® Plus 488 Fluorescent Dye | 
| Excitation/Emission maxima wavelengths | 493 nm / 522 nm | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | P11137 | 
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
Microtubule-associated protein 2 (MAP2) is a tubulin binding protein regulating the spacing and stability of microtubules and contributing to elongation of dendrites.
What is the molecular weight of MAP2? Is MAP2 post-translationally modified?
MAP2 has multiple isoforms that arise from alternative splicing (PMID: 3121794, 7854050, and 10383434). They are classified into two groups - MAP2A and MAP2B, which are known as high molecular weight (HMW) isoforms, run as ~280 kDa species, while low molecular weight (LMW) isoforms MAP2C and MAP2D are around ~70 kDa. MAP2 proteins are heavily phosphorylated, which contributes to a large discrepancy between their predicted and observed molecular weight in SDS-PAGE (220 vs 280 kDa for HMW forms).
What is the tissue expression pattern of MAP2? What is the subcellular localization of MAP2?
MAP2 isoforms differ in their tissue and developmental expression pattern (PMID: 2469170 and 3898077). In the brain, MAP2B is widely expressed during and post development, MAP2A is expressed postnatally, while MAP2C is present only in the early development except of present in photosensitive cells of the adult retina and in the olfactory system. MAP proteins are highly expressed in the CNS found in cell bodies and dendrites of neurons, in dorsal root ganglion, reactive glia, and in the testis (PMID: 9588626). In neurons, MAP2 proteins are found in the cell body and dendrites, where they associate with microtubules, while they can also be present in the nuclei of testicular cells.
Can MAP2 be used as a neuronal marker?
MAP2 proteins are abundantly expressed in neurons. MAP2 is frequently used as a dendritic marker because it is present in the cell body and dendrites of neurons but absent in axons (PMID: 28413822).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 488 MAP2 antibody CL488-17490 | Download protocol | 
| IF protocol for CL Plus 488 MAP2 antibody CL488-17490 | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 




