Validation Data Gallery
Tested Applications
Positive IHC detected in | human tonsillitis tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
Biotin-28076 targets PD-L1/CD274 (C-terminal) in IHC applications and shows reactivity with Human, mouse, rat samples.
Tested Reactivity | Human, mouse, rat |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag27557 Product name: Recombinant human PD-L1/CD274 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 181-290 aa of BC074984 Sequence: TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTHLVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET 相同性解析による交差性が予測される生物種 |
Full Name | CD274 molecule |
Calculated molecular weight | 290 aa, 33 kDa |
Observed molecular weight | 45-50 kDa |
GenBank accession number | BC074984 |
Gene Symbol | PD-L1 |
Gene ID (NCBI) | 29126 |
RRID | AB_2918943 |
Conjugate | Biotin |
Form | |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9NZQ7 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
PD-L1, also known as CD274 or B7H1, stands for programmed cell death ligand 1. It is a type I transmembrane protein that is thought to repress immune responses by binding to its receptor (PD1), thus inhibiting T-cell activation, proliferation, and cytokine production. It contains V-like and C-like immunoglobulin domains. PD-L1 expression is regulated by various cytokines, such as TNF-α or LPS (ISSN: 1848-7718). Increased expression of this protein in certain types of cancers, e.g., renal cell carcinoma or colon cancer, correlates with poor prognosis.
What is the molecular weight of PD-L1?
Depending on the isoform, the calculated molecular weight of the protein varies between 20 and 33 kDa (176-290 aa).
What are the isoforms of PD-L1?
According to NCBI, three different isoforms have been identified. There are significant differences in the untranslated and protein coding regions.
What is the subcellular localization and tissue specificity of PD-L1?
It is predicted to localize in the plasma membrane of various cell types, with a particularly high expression in placental trophoblast and subsets of immune cells. High levels of PD-L1 protein have also been detected in lung and colon tissues.
What is the function of PD-L1 in immune responses?
PD-L1 is critical for the induction and maintenance of immune self-tolerance during infection or inflammation in normal tissues. The interaction of PD-L1 and its receptors is responsible for preventing auto-immune phenotypes and balancing the overall immune response in situations such as pregnancy or tissue allografts. The interaction between PD-L1 and PD-1 or B7.1 starts an inhibitory signaling cascade, which results in the decreased proliferation of antigen-specific T-cells and increased survival of regulatory T-cells (PMID: 15240681).
How can PD-L1's implication in cancer be used as a drug target?
In certain tumors, high expression of PD-L1 serves as a stop-sign to inhibit the recognition of cancer cells by T-cells (PMID: 23087408). The interaction between PD-L1 and its receptors (PD1 and B7.1) is a mechanism for the tumor to evade the host immune response (PMID: 29357948). Several mAbs have been developed to target that interaction and thus prevent the inactivation of cytotoxic T-cells by the tumor (PMIDs: 23890059, 18173375).
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for Biotin PD-L1/CD274 (C-terminal) antibody Biotin-28076 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
ACS Appl Mater Interfaces Harnessing Spatiotemporal-Specific Tumorous Exosome Dynamics: Ultra-Sensitive Lanthanide Luminescence Detection Strategy Enabled by Exosomal Membrane Engineering for Melanoma Immunotherapy Monitoring |