Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse brain tissue, human brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human brain tissue, human cerebellum tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, SH-SY5Y cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:20000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 14 publications below |
| IHC | See 1 publications below |
| IF | See 2 publications below |
Product Information
14364-1-AP targets PKC Gamma in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5681 Product name: Recombinant human PRKCG protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 351-697 aa of BC047876 Sequence: FSFLMVLGKGSFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQLHSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRDLKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGSGPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRLVLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM 相同性解析による交差性が予測される生物種 |
| Full Name | protein kinase C, gamma |
| Calculated molecular weight | 78 kDa |
| Observed molecular weight | 76-80 kDa |
| GenBank accession number | BC047876 |
| Gene Symbol | PKC Gamma |
| Gene ID (NCBI) | 5582 |
| RRID | AB_2300044 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P05129 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC gamma is a neuron-specific member of the classical PKCs and is activated and translocated to subcellular regions as a result of various stimuli, including diacylglycerol synthesis, increased intracellular Ca(2+) and phorbol esters. Defects in this protein have been associated with spinocerebellar ataxia type 14 (SCA14), an autosomal dominant neurodegenerative disease.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for PKC Gamma antibody 14364-1-AP | Download protocol |
| IF protocol for PKC Gamma antibody 14364-1-AP | Download protocol |
| IHC protocol for PKC Gamma antibody 14364-1-AP | Download protocol |
| IP protocol for PKC Gamma antibody 14364-1-AP | Download protocol |
| WB protocol for PKC Gamma antibody 14364-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Sci Adv Global ubiquitylation analysis of mitochondria in primary neurons identifies endogenous Parkin targets following activation of PINK1. | ||
Chemosphere Perinatal exposure to nonylphenol impairs dendritic outgrowth of cerebellar Purkinje cells in progeny. | ||
Cell Oncol (Dordr) The SLITRK4-CNPY3 axis promotes liver metastasis of gastric cancer by enhancing the endocytosis and recycling of TrkB in tumour cells | ||
J Neurosci Dendritic Spine Dynamics after Peripheral Nerve Injury: An Intravital Structural Study. | ||
J Ethnopharmacol Analgesic effects and possible mechanisms of iridoid glycosides from Lamiophlomis rotata (Benth.) Kudo in rats with spared nerve injury. | ||
Inflamm Bowel Dis LRRC19 Promotes Permeability of the Gut Epithelial Barrier Through Degrading PKC-ζ and PKCι/λ to Reduce Expression of ZO1, ZO3, and Occludin. |











