Validation Data Gallery
Tested Applications
| Positive WB detected in | A549 cells, HeLa cells, NIH/3T3 cells |
| Positive IP detected in | A549 cells |
| Positive IHC detected in | human breast cancer tissue, human pancreas cancer tissue, human colon cancer tissue, mouse spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse spleen tissue, mouse lung tissue |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 33 publications below |
| IHC | See 21 publications below |
| IF | See 35 publications below |
| IP | See 1 publications below |
| ELISA | See 1 publications below |
Product Information
16105-1-AP targets S100A4 in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9019 Product name: Recombinant human S100A4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC016300 Sequence: MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK 相同性解析による交差性が予測される生物種 |
| Full Name | S100 calcium binding protein A4 |
| Calculated molecular weight | 101 aa, 12 kDa |
| Observed molecular weight | 10-12 kDa |
| GenBank accession number | BC016300 |
| Gene Symbol | S100A4 |
| Gene ID (NCBI) | 6275 |
| ENSEMBL Gene ID | ENSG00000196154 |
| RRID | AB_11042591 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P26447 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
S100A4 is a member of the S100 family of calcium-binding proteins. The S100 family members have been involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100A4 is known to localize to and function in the nucleus, cytoplasm of cells, and the extracellular space. S100A4 has also been shown to be associated with tumor growth, motility, invasion, metastasis, angiogenesis, apoptosis, and chemoresistance. It is a fibroblast-specific protein associated with mesenchymal cell morphology and motility, is expressed during epithelial-mesenchymal transformations (EMT) in vivo (PMID: 9362334). It is a specific prognostic marker for renal survival in patients with IgAN (PMID: 16105038). It is also an improved marker for lung fibroblasts that could be useful for investigating the pathogenesis of pulmonary fibrosis(PMID: 15618458). Overexpression of S100A4 is correlated with a worse prognosis inpatients with various types of cancer.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for S100A4 antibody 16105-1-AP | Download protocol |
| IF protocol for S100A4 antibody 16105-1-AP | Download protocol |
| IHC protocol for S100A4 antibody 16105-1-AP | Download protocol |
| WB protocol for S100A4 antibody 16105-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Suppression of Enhancer Overactivation by a RACK7-Histone Demethylase Complex.
| ||
J Hematol Oncol Proteogenomic insights into the biology and treatment of pancreatic ductal adenocarcinoma | ||
Nat Commun Co-evolution of matrisome and adaptive adhesion dynamics drives ovarian cancer chemoresistance. | ||
ACS Appl Mater Interfaces Smart Manganese Dioxide-Based Lanthanide Nanoprobes for Triple-Negative Breast Cancer Precise Gene Synergistic Chemodynamic Therapy. | ||
Oncogene Stromal nicotinamide N-methyltransferase orchestrates the crosstalk between fibroblasts and tumour cells in oral squamous cell carcinoma: evidence from patient-derived assembled organoids | ||
J Crohns Colitis Exosomal miR-103a-3p from Crohn's creeping fat-derived ASCs contributes to intestinal fibrosis by targeting TGFBR3 and activating fibroblasts |















