Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, Jurkat cells, mouse brain tissue, mouse liver tissue, rat liver tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human breast cancer tissue, human pancreas cancer tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, HepG2 cells, U2OS cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 4 publications below |
| WB | See 46 publications below |
| IHC | See 1 publications below |
| IF | See 18 publications below |
| IP | See 2 publications below |
| CoIP | See 2 publications below |
Product Information
14477-1-AP targets VAPB in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5857 Product name: Recombinant human VAPB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 31-180 aa of BC001712 Sequence: KLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEV 相同性解析による交差性が予測される生物種 |
| Full Name | VAMP (vesicle-associated membrane protein)-associated protein B and C |
| Calculated molecular weight | 27 kDa |
| Observed molecular weight | 27 kDa |
| GenBank accession number | BC001712 |
| Gene Symbol | VAPB |
| Gene ID (NCBI) | 9217 |
| RRID | AB_2288297 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95292 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Vesicle-associated membrane protein-associated protein B (VAPB) is an integral membrane protein localized to the endoplasmic reticulum (ER) membrane. VAPB has been implicated in various cellular processes, including ER stress, the unfolded protein response (UPR) and calcium homeostasis regulation. The mutations in the gene of VAPB cause amyotrophic lateral sclerosis 8 (ALS8) and some other related forms of motor neuron disease including late-onset spinal muscular atrophy.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for VAPB antibody 14477-1-AP | Download protocol |
| IF protocol for VAPB antibody 14477-1-AP | Download protocol |
| IHC protocol for VAPB antibody 14477-1-AP | Download protocol |
| IP protocol for VAPB antibody 14477-1-AP | Download protocol |
| WB protocol for VAPB antibody 14477-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Cell Biol MIROs and DRP1 drive mitochondrial-derived vesicle biogenesis and promote quality control. | ||
Cell Res DNA damage triggers tubular endoplasmic reticulum extension to promote apoptosis by facilitating ER-mitochondria signaling. | ||
Mol Cell MIGA2 Links Mitochondria, the ER, and Lipid Droplets and Promotes De Novo Lipogenesis in Adipocytes. | ||
J Clin Invest SPTLC1 variants associated with ALS produce distinct sphingolipid signatures through impaired interaction with ORMDL proteins. | ||
Cancer Res Proteomic mapping and targeting of mitotic pericentriolar material in tumors bearing centrosome amplification. |












