Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, zebrafish tissue, Jurkat cells, K-562 cells, Hsc-T6 cells, NIH/3T3 cells, mouse brain, rat brain |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human colon tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse eye tissue |
| Positive IF/ICC detected in | C2C12 cells, HeLa cells, HepG2 cells |
| Positive FC (Intra) detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 16 publications below |
| IF | See 3 publications below |
Product Information
80713-1-RR targets Beta Tubulin in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat, zebrafish samples.
| Tested Reactivity | human, mouse, rat, zebrafish |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag0117 Product name: Recombinant human Tubulin-beta protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 44-259 aa of BC000748 Sequence: LERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVP 相同性解析による交差性が予測される生物種 |
| Full Name | tubulin, beta 3 |
| Calculated molecular weight | 450 aa, 50 kDa |
| Observed molecular weight | 50-55 kDa |
| GenBank accession number | BC000748 |
| Gene Symbol | TUBB3 |
| Gene ID (NCBI) | 10381 |
| RRID | AB_2918906 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q13509 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
There are five tubulins in human cells: alpha, beta, gamma, delta, and epsilon. Tubulins are conserved across species. They form heterodimers, which multimerize to form a microtubule filament. An alpha and beta tubulin heterodimer is the basic structural unit of microtubules. The heterodimer does not come apart, once formed. The alpha and beta tubulins, which are each about 55 kDa MW, are homologous but not identical. Alpha, beta, and gamma tubulins have all been used as loading controls. Tubulin expression may vary according to resistance to antimicrobial and antimitotic drugs.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Beta Tubulin antibody 80713-1-RR | Download protocol |
| IF protocol for Beta Tubulin antibody 80713-1-RR | Download protocol |
| IHC protocol for Beta Tubulin antibody 80713-1-RR | Download protocol |
| IP protocol for Beta Tubulin antibody 80713-1-RR | Download protocol |
| WB protocol for Beta Tubulin antibody 80713-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Front Pharmacol Multi-omics reveal the neuroprotective mechanisms of Xinshubao tablet against scopolamine-induced cognitive dysfunction in mice | ||
J Inflamm Res Tenascin-C Facilitates Microglial Polarization via TLR4/MyD88/NF-κB Pathway Following Subarachnoid Hemorrhage | ||
Exp Neurol Integrative multi-omics and machine learning identify CALR as a diagnostic and therapeutic target in aneurysmal subarachnoid hemorrhage | ||
Med Gas Res Mechanism by which hydrogen-rich water mitigates exercise-induced fatigue: activation of the immunoresponsive gene 1-itaconate/nuclear factor erythroid 2-related factor 2/heme oxygenase-1 pathway | ||
Adv Healthc Mater Accurate Neurotransmitter Release by Ultrasound-Responsive Nanomaterials for Alleviating L-DOPA-Induced Dyskinesia in Parkinson's Disease |
















