Validation Data Gallery
Tested Applications
| Positive WB detected in | THP-1 cells, U-937 cells, HL-60 cells |
| Positive IHC-Autostainer detected in | human tonsil tissue |
| Positive IHC detected in | rat brain tissue, mouse brain tissue, human liver tissue, human tonsil tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat brain tissue |
| Positive FC (Intra) detected in | THP-1 cells |
This antibody is not recommended for frozen sections.
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC)-AUTOSTAINER | IHC-AUTOSTAINER : 1:50-1:500 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:250-1:1000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 6 publications below |
| IHC | See 5 publications below |
| IF | See 16 publications below |
| ELISA | See 1 publications below |
Product Information
81728-1-RR targets IBA1 in WB, IHC, IHC-Autostainer, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag1363 Product name: Recombinant human IBA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-147 aa of BC009474 Sequence: MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP 相同性解析による交差性が予測される生物種 |
| Full Name | allograft inflammatory factor 1 |
| Calculated molecular weight | 17 kDa |
| Observed molecular weight | 17 kDa |
| GenBank accession number | BC009474 |
| Gene Symbol | IBA1 |
| Gene ID (NCBI) | 199 |
| ENSEMBL Gene ID | ENSG00000204472 |
| RRID | AB_2935574 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P55008 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
IBA1 is a 143 amino acid cytoplasmic, inflammation response scaffold protein. It is constitutively expressed in monocytes and macrophages and is known to be involved in macrophage activation. It is a marker of activated macrophage. Expression of IBA1 is up-regulated in activated microglia following facial nerve axotomy, ischemia, and several brain diseases, thereby implicating it in the activated phenotypes of microglia.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for IBA1 antibody 81728-1-RR | Download protocol |
| IF protocol for IBA1 antibody 81728-1-RR | Download protocol |
| IHC protocol for IBA1 antibody 81728-1-RR | Download protocol |
| WB protocol for IBA1 antibody 81728-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Pharmaceutics MOF-Engineered Platelet-Mimicking Nanocarrier-Encapsulated Cascade Enzymes for ROS Scavenging and Anti-Inflammation in Cerebral Ischemia-Reperfusion Injury. | ||
J Neurochem Integrative Analysis of DNA Methylation and Gene Expression Reveals Key Molecular Signatures in Spatial Memory Impairment of Sepsis-Associated Encephalopathy | ||
Biochem Biophys Res Commun Allograft inflammatory factor-1 in macrophages promotes renal tubular cell epithelial-mesenchymal transition via the NF-κB/IL-1β axis in diabetic kidney disease. | ||
Eur J Pharmacol Edaravone-dexborneol improves neurological function after cerebral ischemia-reperfusion injury by activating NRF2/p62 and suppressing NF-κB/NLRP3 signaling. | ||
Mol Pain miRNA-let7b5p alleviates visceral hypersensitivity by inhibiting the activation of spinal microglial in male IBS-like rats. | ||
BMB Rep Corin inhibits microglial inflammatory activation by suppressing mitochondrial dysfunction in intracerebral hemorrhage. |
















