Validation Data Gallery
Tested Applications
Positive WB detected in | mouse colon tissue, Caco-2 cells, human colon tissue, mouse stomach tissue, rat colon tissue |
Positive IHC detected in | mouse heart tissue, human colon cancer tissue, human heart tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse heart tissue |
Positive IF-Fro detected in | mouse heart tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 110 publications below |
IHC | See 22 publications below |
IF | See 49 publications below |
IP | See 1 publications below |
FC | See 1 publications below |
Product Information
10493-1-AP targets transgelin/SM22 in WB, IHC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, canine, bovine |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0764 Product name: Recombinant human TAGLN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC004927 Sequence: MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS 相同性解析による交差性が予測される生物種 |
Full Name | transgelin |
Calculated molecular weight | 22 kDa |
Observed molecular weight | 19-22 kDa |
GenBank accession number | BC004927 |
Gene Symbol | transgelin/SM22 |
Gene ID (NCBI) | 6876 |
RRID | AB_2199363 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q01995 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
The transgelin family is a protein group belonging to the 22kd actin-related calponin superfamily. Of all three isoforms, transgelin 1 is the best characterized. Transgelin 1, or SM22alpha, is a specific marker for differentiated smooth muscle cells. Transgelin 2, also known as SM22 beta, is expressed by both smooth and non-smooth muscle cells in a temporally and spatially regulated pattern. Trangenlin 3, also known as NP25, is only found in highly differentiated neuronal cells. This antibody was generated against full-length transgelin 1 protein. It can cross-react with other two transgenes based on the sequence similarity.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for transgelin/SM22 antibody 10493-1-AP | Download protocol |
IHC protocol for transgelin/SM22 antibody 10493-1-AP | Download protocol |
IF protocol for transgelin/SM22 antibody 10493-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Host Microbe Gut microbiome dysbiosis contributes to abdominal aortic aneurysm by promoting neutrophil extracellular trap formation | ||
Acta Pharm Sin B The substitution of SERCA2 redox cysteine 674 promotes pulmonary vascular remodeling by activating IRE1α/XBP1s pathway. | ||
J Exp Med Dependence of proliferative vascular smooth muscle cells on CD98hc (4F2hc, SLC3A2). | ||
Nat Commun Hyperlipidemia-induced cholesterol crystal production by endothelial cells promotes atherogenesis. | ||
Circ Res Peptide-mediated disruption of calmodulin-cyclin E interactions inhibits proliferation of vascular smooth muscle cells and neointima formation. |