Validation Data Gallery
Tested Applications
Positive WB detected in | rabbit brain tissue, PC-12 cells, fetal human brain tissue, rat brain tissue, mouse brain tissue, pig cerebellum tissue, rabbit cerebellum tissue, rat cerebellum tissue, mouse cerebellum tissue |
Positive IHC detected in | rat cerebellum tissue, human kidney tissue, human small intestine tissue, human brain tissue, mouse kidney tissue, rat kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse cerebellum tissue, human kidney tissue, rat cerebellum tissue |
Positive IF-Fro detected in | mouse cerebellum tissue, rat cerebellum tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunohistochemistry (IHC) | IHC : 1:8000-1:32000 |
Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
Immunofluorescence (IF)-FRO | IF-FRO : 1:400-1:1600 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IHC | See 3 publications below |
IF | See 9 publications below |
Product Information
66394-1-Ig targets Calbindin-D28k in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
Tested Reactivity | human, mouse, rat, pig, rabbit |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag5861 Product name: Recombinant human Calbindin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 109-261 aa of BC006478 Sequence: KYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN 相同性解析による交差性が予測される生物種 |
Full Name | calbindin 1, 28kDa |
Calculated molecular weight | 30 kDa |
Observed molecular weight | 28 kDa |
GenBank accession number | BC006478 |
Gene Symbol | Calbindin |
Gene ID (NCBI) | 793 |
RRID | AB_2881769 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P05937 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Calbindin-D28k is a member of the calcium-binding protein superfamily that includes calmodulin and troponin C. It is a cytosolic calcium binding protein highly expressed in the distal tubule, intestines, central nervous system, primary murine osteoblast cells and in several other organs. It plays an important role in the intracellular calcium homeostasis, its strong buffering capacity prevents cytotoxic effect of high concentration of free calcium in kidney, brain, pancreas, and intestine.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Calbindin-D28k antibody 66394-1-Ig | Download protocol |
IHC protocol for Calbindin-D28k antibody 66394-1-Ig | Download protocol |
IF protocol for Calbindin-D28k antibody 66394-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Adv Sci (Weinh) Integrative Single-Cell Transcriptomics and Epigenomics Mapping of the Fetal Retina Developmental Dynamics | ||
Cell Death Differ The long noncoding RNA Synage regulates synapse stability and neuronal function in the cerebellum. | ||
iScience Mutational burden of XPNPEP3 leads to defects in mitochondrial complex I and cilia in NPHPL1 | ||
Int Immunopharmacol Clinical significance of Interleukin 17 receptor E in diabetic nephropathy | ||
Front Mol Neurosci Inflammasome Inhibition Prevents Motor Deficit and Cerebellar Degeneration Induced by Chronic Methamphetamine Administration. | ||
Front Neurosci Rodent Area Prostriata Converges Multimodal Hierarchical Inputs and Projects to the Structures Important for Visuomotor Behaviors. |