Validation Data Gallery
Tested Applications
Positive WB detected in | HeLa cells, HEK-293T |
Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 6 publications below |
WB | See 16 publications below |
IHC | See 2 publications below |
IF | See 4 publications below |
IP | See 2 publications below |
CoIP | See 1 publications below |
Product Information
66297-1-Ig targets Sestrin 2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, pig, rat samples.
Tested Reactivity | human, pig, rat |
Cited Reactivity | human, mouse, rat, pig, bovine |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag20638 Product name: Recombinant human Sestrin2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 132-480 aa of BC013304 Sequence: HMAEFLQTGGDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQALLKTGEHTWSLAELIQALVLLTHCHSLSSFVFGCGILPEGDADGSPAPQAPTPPSEQSSPPSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLVTPSADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERNLKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT 相同性解析による交差性が予測される生物種 |
Full Name | sestrin 2 |
Calculated molecular weight | 54 kDa |
Observed molecular weight | 54 kDa |
GenBank accession number | BC013304 |
Gene Symbol | SESN2/Sestrin 2 |
Gene ID (NCBI) | 83667 |
RRID | AB_2881680 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P58004 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Sestrins, including sestrin-1 (PA26), sestrin-2 (Hi95), and sestrin-3, are 48 to 65 kDa cystein sulfinyl reductases and they modulate peroxide signaling and antioxidant defense. These proteins selectively reduce or repair hyperoxidized forms of typical 2-Cys peroxiredoxins within eukaryotes. Expression of these proteins is regulated by p53, a tumor suppressor protein. Sestrin 2 is implicated in the regulation of cell survival, in cellular responses to different stress conditions, and also acts as a positive regulator of autophagy. Sestrin 2 is approximately a 57.6kDa protein (480 amino acids).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Sestrin 2 antibody 66297-1-Ig | Download protocol |
IHC protocol for Sestrin 2 antibody 66297-1-Ig | Download protocol |
IF protocol for Sestrin 2 antibody 66297-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Biol Toxicol Induction of Sestrin2 by pterostilbene suppresses ethanol-triggered hepatocyte senescence by degrading CCN1 via p62-dependent selective autophagy.
| ||
Front Cell Dev Biol Histone Demethylase JMJD3 Mediated Doxorubicin-Induced Cardiomyopathy by Suppressing SESN2 Expression. | ||
Osteoarthritis Cartilage Suppression of Sestrins in aging and osteoarthritic cartilage: dysfunction of an important stress defense mechanism. | ||
J Nutr Intermittent Bolus Compared With Continuous Feeding Enhances Insulin and Amino Acid Signaling to Translation Initiation in Skeletal Muscle of Neonatal Pigs. | ||
Cell Tissue Res Sestrin2 attenuates renal damage by regulating Hippo pathway in diabetic nephropathy. | ||
Am J Physiol Endocrinol Metab Prematurity blunts the insulin- and amino acid-induced stimulation of translation initiation and protein synthesis in skeletal muscle of neonatal pigs. |